SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019139 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019139
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily EF-hand 0.000000000861
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019139   Gene: ENSCSAVG00000011240   Transcript: ENSCSAVT00000019346
Sequence length 179
Comment pep:novel reftig:CSAV2.0:reftig_14:1672214:1674311:1 gene:ENSCSAVG00000011240 transcript:ENSCSAVT00000019346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLLFNVFDLNKTGYLTLQQFKDMFRCMVDTFSSIADQAAVEEVLNKIVPLQLDQEDGQL
NFAEFKNLLCQLELDKIVLPFNAPEKKSKSPLKRKVSKHDRVQQARKLYENKTPLNSLTE
QNENTSEARAVVLEVSSRLRSVRRWFECYARHVFWVSFYCWITLGVFLWSFNAVNSKKS
Download sequence
Identical sequences H2ZNH3
ENSCSAVP00000019139 51511.ENSCSAVP00000019139 ENSCSAVP00000019139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]