SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019459 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019459
Domain Number 1 Region: 4-233
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-88
Family Calponin-homology domain, CH-domain 0.00000161
Further Details:      
 
Domain Number 2 Region: 252-370
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-33
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 3 Region: 970-1125
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-29
Family Spectrin repeat 0.0000238
Further Details:      
 
Domain Number 4 Region: 559-695
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-28
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 5 Region: 1411-1552
Classification Level Classification E-value
Superfamily Spectrin repeat 4.73e-28
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 6 Region: 859-1017
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-28
Family Spectrin repeat 0.00083
Further Details:      
 
Domain Number 7 Region: 2120-2224
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-27
Family Pleckstrin-homology domain (PH domain) 0.0000735
Further Details:      
 
Domain Number 8 Region: 1823-1975
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 1717-1872
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 1187-1340
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-25
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 11 Region: 1509-1658
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 12 Region: 380-479
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-22
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 13 Region: 704-804
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-19
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 14 Region: 474-591
Classification Level Classification E-value
Superfamily Spectrin repeat 4.46e-19
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 15 Region: 1981-2053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000471
Family Spectrin repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019459
Domain Number - Region: 1349-1437
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0273
Family Spectrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019459   Gene: ENSCSAVG00000011411   Transcript: ENSCSAVT00000019669
Sequence length 2257
Comment pep:novel reftig:CSAV2.0:reftig_1:4528744:4558348:-1 gene:ENSCSAVG00000011411 transcript:ENSCSAVT00000019669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SILDEREAVQKKTFTKWVNSHLVRVSCRIQDLYMDLRDGRSLIKLLEILSGERLPKPTRG
KMRIHCLENTGKALQFLKSKKVHLENMGPHDIVDGNHRLILGLIWTIILRFQIQDISVET
EDNRETRSAKDALLLWCQMKTAGYANVNVHNFNTSWRDGLAFNAIIHKHRPDLIDYDSLK
KSNAMHNLQNAFNVAEQQLGLTKLLDPEDIVVERPDEKSIITYVVTYYHYFSKMKAIAVE
GKRIGKVLDSALESNQMVEKYDSLASDLLDWIEQTIEILNDRTFANSLSGVSAQLAAFNN
YRTAEKPQKFQEKGNLEVLLFTLQSKMRANNQKPYLPKEGKLVSDINKAWEKLEKAEHGR
ELAIRNELIRQERLELLASRFDRKAAMRETWLSENQKLVTQDNFGGDLPAVEAATKKHEA
IETDVKAYEERVQAVVDVASELQREDYHDITRVNQRKDNVLQLWEYLLELLQGRRTRLEL
NVRLQQMFEEMMSLLDWMDDMKGQLANEDLGQHLMGVEDILQKHMLLEQDITVHGDRVKA
IESQSQEFLQPTNDYSACEPSAVEDKVVGVRTTYDQLCKQAADRRAKLDESRRMHLFFAT
MAEEVAWVKEKEQLLNSDDLGRDLTSVHSLLTKQKALEDEMNGRKAMLANAIAVGEDLIS
EDHFASQDIAKHISDINEQWKNLEELAEARNELLKESKQTLPVIFYADTDDVDTWLVDMF
RIVSTDDCGRDEPSVLSLLKKHAQVQEELTKYEGVIKALHDEADGLTEKDRESVEVQERL
RSVDSRYKELLDFAKLRKEKLIDARALYKFYGEADTISAWIAEKEQVLENMLVPDNIEDM
ELVQHRFEGYENEVNKLAPQVAVVNQMARGLVQTQHPNSDDVSAKQNELNARWNALRALL
EERREILASAKGLHGFKLECDETEGWIKDKARVLAAGAEDQLSDRDLAGVVALQRKLSSM
ELDLAAIQAKLDNLRDEADRLSNEHPEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
GNLQKFLRDLDRFQAWLSTTQTTIASEDMPQSLPEAEKLLQQHQAIKLEIDNYQADYEEI
KSTGAQVTSGREDEPQYMFLGQRLQALDQGWIELHKMWENRNHFLNEAKEYQAFIRDCKQ
AEQILTNQEYALESARRSSAAASTPDSAEEVMKKHEAFVATMASADERVEAVLRDAGKLA
DADHHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDNLALQKFVADCDELSEWVNEKML
TAKDATYDDARNLHSKWQKHQAFSAELTANKDRLERLEEDGSTLAKSKPEWKDQIDVRLD
DLRKHWEALESCTKTKEKTLFEANKAELFSQTCEDLEKFASMMEEQLNSDDVGKDLASVN
VLLKDHLAQQDEIEVRKQEVQELESQAAVLRSEGDEDVDTMNEERAKIKHRIEDLDEPLT
KRKDALENSKQLHQFYRDVQDEKLWIDEKHPQATSNELGNSLQEVQALQKKHQALRSELT
AHEPVVVAVCHRGVAMATEDNPNTDKINEKCHELQENWNRLLEDVDERKRKLSEAENAQQ
YFFDADEAVVLMEEQELYMMSDEKAKDSQGATKMLKKHQAQEQNIDDFADTIQQLSKTCR
DLCEQEHPQSEQLSTRQQQVDQTYAGLKDLAEERRMKLRERCDLFRLSRDIDDLEQWIAQ
REVVAASQEQGQDFDHVSMLQDQFNDFQRDTIKTGEERVADAMRMSDELINAGHTDAQDI
AGWKDTIRDAWADLLELIDTRVEMLAAAYALHKFHYDAAEILARIQEKRQEVPEELGRDH
DAVENFKREHDIFAQDIKAIGAQVEAITSAGSELEGRYAGDDLQEIQKKIEAVLSAWNNL
LSLVKKRAALLSDALNKFRFFNMCRDLMDWMESTVRQIDLQEKPRDVSGVETAMSLHQGT
KAEIDARNGSFEECTQLGQHLITTGHYASDEIRVKLDELGAKRNHVVDRWQEKWELNLLM
EVYQFAHDANTCDAWVQQQLGLIRDMPVDTCRSADDADQLLRRLDGFEKAAVPWEDRFAA
LEKLTEVSQEEQEKKRKEEEEQEERRRKAEEDEQKIKKEAELEAARVQAIESMLNGVNGE
TSGEGVVDGEDARSPEMKSHEGMLQRKQERDADGRKASNRSWNSVFCVLQDKNLAFYKDP
KAASQRASFHGEQSISLENATIEIASDYKKRKNVLRLRLSAGMEYLFQAKDEEELNVWLN
RLQSQNLNASIGSGVSTPSRASPKSKKRRSFLKGGKK
Download sequence
Identical sequences H2ZPE3
ENSCSAVP00000019459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]