SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019460 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019460
Domain Number 1 Region: 33-284
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.65e-90
Family Calponin-homology domain, CH-domain 0.00000161
Further Details:      
 
Domain Number 2 Region: 303-421
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-33
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 3 Region: 1020-1176
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-29
Family Spectrin repeat 0.0000238
Further Details:      
 
Domain Number 4 Region: 1460-1603
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-28
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 5 Region: 609-745
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-28
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 6 Region: 1873-2025
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 2212-2328
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-27
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 8 Region: 823-957
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-26
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 9 Region: 1237-1390
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-25
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 10 Region: 1559-1708
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 11 Region: 431-530
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-22
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 12 Region: 754-854
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-19
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 13 Region: 1767-1884
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-18
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 14 Region: 535-642
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-17
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 15 Region: 2031-2103
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000051
Family Spectrin repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019460
Domain Number - Region: 1399-1487
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019460   Gene: ENSCSAVG00000011411   Transcript: ENSCSAVT00000019670
Sequence length 2329
Comment pep:novel reftig:CSAV2.0:reftig_1:4529248:4568000:-1 gene:ENSCSAVG00000011411 transcript:ENSCSAVT00000019670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVQRNAPDYADDESYDMEEFIDKRWVDVEFEEEETDLDNSSARLFERSRIKALADEREAV
QKKTFTKWVNSHLVRVSCRIQDLYMDLRDGRSLIKLLEILSGERLPKPTRGKMRIHCLEN
TGKALQFLKSKKVHLENMGPHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNRETRSA
KDALLLWCQMKTAGYANVNVHNFNTSWRDGLAFNAIIHKHRPDLIDYDSLKKSNAMHNLQ
NAFNVAEQQLGLTKLLDPEDIVVERPDEKSIITYVVTYYHYFSKMKAIAVEGKRIGKVLD
SALESNQMVEKYDSLASDLLDWIEQTIEILNDRTFANSLSGVSAQLAAFNNYRTAEKPQK
FQEKGNLEVLLFTLQSKMRANNQKPYLPKEGKLVSDINKAWEKLEKAEHGRELAIRNELI
RQERLELLASRFDRKAAMRETWLSENQKLVTQDNFGGDLPAVEAATKKHEAIETDVKAYE
ERVQAVVDVASELQREDYHDITRVNQRKDNVLQLWEYLLELLQGRRTRLELNVRLQQMFE
EMMSLLDWMDDMKGQLANEDLGQHLMGVEDILQKHMLLEQDITVHGDRVKAIESQSQEFL
QPTNDYSACEPSAVEDKVVGVRTTYDQLCKQAADRRAKLDESRRMHLFFATMAEEVAWVK
EKEQLLNSDDLGRDLTSVHSLLTKQKALEDEMNGRKAMLANAIAVGEDLISEDHFASQDI
AKHISDINEQWKNLEELAEARNELLKLSKLLGRIFYADTDDVDTWLVDMFRIVSTDDCGR
DEPSVLSLLKKHAQVQEELTKYEGVIKALHDEADGLTEKDRESVEVQERLRSVDSRYKEL
LDFAKLRKEKLIDARALYKFYGEADTISAWIAEKEQVLENMLVPDNIEDMELVQHRFEGY
ENEVNKLAPQVAVVNQMARGLVQTQHPNSDDVSAKQNELNARWNALRALLEERREILASA
KGLHGFKLECDETEGWIKDKARVLAAGAEDQLSDRDLAGVVALQRKLSSMELDLAAIQAK
LDNLRDEADRLSNEHPEEADEIRKKFEQMERVWQELRDMLRQREDSLGEAGNLQKFLRDL
DRFQAWLSTTQTTIASEDMPQSLPEAEKLLQQHQAIKLEIDNYQADYEEIKSTGAQVTSG
REDEPQYMFLGQRLQALDQGWIELHKMWENRNHFLNEAKEYQAFIRDCKQAEQILTNQEY
ALESARRSSAAASTPDSAEEVMKKHEAFVATMASADERVEAVLRDAGKLADADHHAADKI
KERAEKIAERRAKNKEEAGEVSTMLRDNLALQKFVADCDELSEWVNEKMLTAKDATYDDA
RNLHSKWQKHQAFSAELTANKDRLERLEEDGSTLAKSKPEWKDQIDVRLDDLRKHWEALE
SCTKTKEKTLFEANKAELFSQTCEDLEKFASMMEEQLNSDDVGKDLASVNVLLKDHLAQQ
DEIEVRKQEVQELESQAAVLRSEGDEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENSK
QLHQFYRDVQDEKLWIDEKHPQATSNELGNSLQEVQALQKKHQALRSELTAHEPVVVAVC
HRGVAMATEDNPNTDKINEKCHELQENWNRLLEDVDERKRKLSEAENAQQYFFDADEAVV
LMEEQELYMMSDEKAKDSQGATKMLKKHQAQEQNIDDFADTIQQLSKTCRDLCEQEHPQS
EQLSTRQQQVDQTYAGLKDLAEERRMKLRERCDLFRLSRDIDDLEQWIAQREVVAASQEQ
GQDFDHVSMLQDQFNDFQRDTIKTGEERVADAMRMSDELINAGHTDAQDIAGWKDTIRDA
WADLLELIDTRVEMLAAAYALHKFHYDAAEILARIQEKRQEVPEELGRDHDAVENFKREH
DIFAQDIKAIGAQVEAITSAGSELEGRYAGDDLQEIQKKIEAVLSAWNNLLSLVKKRAAL
LSDALNKFRFFNMCRDLMDWMESTVRQIDLQEKPRDVSGVETAMSLHQGTKAEIDARNGS
FEECTQLGQHLITTGHYASDEIRVKLDELGAKRNHVVDRWQEKWELNLLMEVYQFAHDAN
TCDAWVQQQLGLIRDMPVDTCRSADDADQLLRRLDGFEKAAVPWEDRFAALEKLTEVSQE
EQEKKRKEEEEQEERRRKAEEDEQKIKKEAELEAARVQAIVDAENPKIQNVNPEEHPTNG
AFHFYGSRPTAFVTPLLRNQHMESFNMTPIAGPTVPLTPRRRDLLPSPIMSSTPVHKAMS
PDVPYQGFLKRKSTMFSPSKKAPNRSWNSVFCVLQDKNLAFYKDPKAASQRASFHGEQSI
SLENATIEIASDYKKRKNVLRLRLSAGMEYLFQAKDEEELNVWLNRLQS
Download sequence
Identical sequences H2ZPE4
ENSCSAVP00000019460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]