SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019462 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019462
Domain Number 1 Region: 5-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-88
Family Calponin-homology domain, CH-domain 0.00000226
Further Details:      
 
Domain Number 2 Region: 254-372
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-33
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 3 Region: 969-1125
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-29
Family Spectrin repeat 0.0000238
Further Details:      
 
Domain Number 4 Region: 560-697
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-28
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 5 Region: 1407-1551
Classification Level Classification E-value
Superfamily Spectrin repeat 3.38e-28
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 6 Region: 858-1017
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-28
Family Spectrin repeat 0.00083
Further Details:      
 
Domain Number 7 Region: 1822-1974
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1186-1339
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-25
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 9 Region: 1716-1870
Classification Level Classification E-value
Superfamily Spectrin repeat 4.12e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 1508-1657
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 11 Region: 2153-2261
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-22
Family Pleckstrin-homology domain (PH domain) 0.00016
Further Details:      
 
Domain Number 12 Region: 382-481
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-22
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 13 Region: 700-803
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-21
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 14 Region: 486-593
Classification Level Classification E-value
Superfamily Spectrin repeat 9.76e-18
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 15 Region: 1980-2052
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000393
Family Spectrin repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019462
Domain Number - Region: 1348-1436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0273
Family Spectrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019462   Gene: ENSCSAVG00000011411   Transcript: ENSCSAVT00000019672
Sequence length 2263
Comment pep:novel reftig:CSAV2.0:reftig_1:4529395:4558354:-1 gene:ENSCSAVG00000011411 transcript:ENSCSAVT00000019672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPSILDEREAVQKKTFTKWVNSHLVRVSCRIQDLYMDLRDGRSLIKLLEILSGERLPKPT
RGKMRIHCLENTGKALQFLKSKKVHLENMGPHDIVDGNHRLILGLIWTIILRFQIQDISV
ETEDNRETRSAKDALLLWCQMKTAGYANVNVHNFNTSWRDGLAFNAIIHKHRPDLIDYDS
LKKSNAMHNLQNAFNVAEQQLGLTKLLDPEDIVVERPDEKSIITYVVTYYHYFSKMKAIA
VEGKRIGKVLDSALESNQMVEKYDSLASDLLDWIEQTIEILNDRTFANSLSGVSAQLAAF
NNYRTAEKPQKFQEKGNLEVLLFTLQSKMRANNQKPYLPKEGKLVSDINKAWEKLEKAEH
GRELAIRNELIRQERLELLASRFDRKAAMRETWLSENQKLVTQDNFGGDLPAVEAATKKH
EAIETDVKAYEERVQAVVDVASELQREDYHDITRVNQRKDNVLQLWEYLLELLQGRRTRL
ELNVRLQQMFEEMMSLLDWMDDMKGQLANEDLGQHLMGVEDILQKHMLLEQDITVHGDRV
KAIESQSQEFLQPTNDYSACEPSAVEDKVVGVRTTYDQLCKQAADRRAKLDESRRMHLFF
ATMAEEVAWVKEKEQLLNSDDLGRDLTSVHSLLTKQKALEDEMNGRKAMLANAIAVGEDL
ISEDHFASQDIAKHISDINEQWKNLEELAEARNELLKESKLYQFYADTDDVDTWLVDMFR
IVSTDDCGRDEPSVLSLLKKHAQVQEELTKYEGVIKALHDEADGLTEKDRESVEVQERLR
SVDSRYKELLDFAKLRKEKLIDARALYKFYGEADTISAWIAEKEQVLENMLVPDNIEDME
LVQHRFEGYENEVNKLAPQVAVVNQMARGLVQTQHPNSDDVSAKQNELNARWNALRALLE
ERREILASAKGLHGFKLECDETEGWIKDKARVLAAGAEDQLSDRDLAGVVALQRKLSSME
LDLAAIQAKLDNLRDEADRLSNEHPEEADEIRKKFEQMERVWQELRDMLRQREDSLGEAG
NLQKFLRDLDRFQAWLSTTQTTIASEDMPQSLPEAEKLLQQHQAIKLEIDNYQADYEEIK
STGAQVTSGREDEPQYMFLGQRLQALDQGWIELHKMWENRNHFLNEAKEYQAFIRDCKQA
EQILTNQEYALESARRSSAAASTPDSAEEVMKKHEAFVATMASADERVEAVLRDAGKLAD
ADHHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDNLALQKFVADCDELSEWVNEKMLT
AKDATYDDARNLHSKWQKHQAFSAELTANKDRLERLEEDGSTLAKSKPEWKDQIDVRLDD
LRKHWEALESCTKTKEKTLFEANKAELFSQTCEDLEKFASMMEEQLNSDDVGKDLASVNV
LLKDHLAQQDEIEVRKQEVQELESQAAVLRSEGDEDVDTMNEERAKIKHRIEDLDEPLTK
RKDALENSKQLHQFYRDVQDEKLWIDEKHPQATSNELGNSLQEVQALQKKHQALRSELTA
HEPVVVAVCHRGVAMATEDNPNTDKINEKCHELQENWNRLLEDVDERKRKLSEAENAQQY
FFDADEAVVLMEEQELYMMSDEKAKDSQGATKMLKKHQAQEQNIDDFADTIQQLSKTCRD
LCEQEHPQSEQLSTRQQQVDQTYAGLKDLAEERRMKLRERCDLFRLSRDIDDLEQWIAQR
EVVAASQEQGQDFDHVSMLQDQFNDFQRDTIKTGEERVADAMRMSDELINAGHTDAQDIA
GWKDTIRDAWADLLELIDTRVEMLAAAYALHKFHYDAAEILARIQEKRQEVPEELGRDHD
AVENFKREHDIFAQDIKAIGAQVEAITSAGSELEGRYAGDDLQEIQKKIEAVLSAWNNLL
SLVKKRAALLSDALNKFRFFNMCRDLMDWMESTVRQIDLQEKPRDVSGVETAMSLHQGTK
AEIDARNGSFEECTQLGQHLITTGHYASDEIRVKLDELGAKRNHVVDRWQEKWELNLLME
VYQFAHDANTCDAWVQQQLGLIRDMPVDTCRSADDADQLLRRLDGFEKAAVPWEDRFAAL
EKLTEVSQEEQEKKRKEEEEQEERRRKAEEDEQKIKKEAELEAARPRRRFASNRSTHGDH
STPFVHADDVMVPRRRLFSNQQVLTHKVVASVHSDINGPRVSGAQYTQTPVKMRQKAPQD
SESPDVPYQGFLKRKSTMFSPSKKAPNRSWNSVFCVLQDKNLAFYKDPKAASQRASFHGE
QSISLENATIEIASDYKKRKNVLRLRLSAGMEYLFQAKDEVSV
Download sequence
Identical sequences H2ZPE6
ENSCSAVP00000019462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]