SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019464 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019464
Domain Number 1 Region: 34-285
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.58e-90
Family Calponin-homology domain, CH-domain 0.00000161
Further Details:      
 
Domain Number 2 Region: 304-422
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-33
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 3 Region: 1022-1178
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-29
Family Spectrin repeat 0.0000238
Further Details:      
 
Domain Number 4 Region: 611-747
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-28
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 5 Region: 1501-1605
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-27
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 6 Region: 1873-2025
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 824-959
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-26
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 8 Region: 1239-1392
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-25
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 9 Region: 1559-1708
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 1767-1910
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-22
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 11 Region: 432-531
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-22
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 12 Region: 2195-2302
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-22
Family Pleckstrin-homology domain (PH domain) 0.00016
Further Details:      
 
Domain Number 13 Region: 756-856
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-19
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 14 Region: 526-643
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-19
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 15 Region: 1392-1506
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000262
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 16 Region: 2031-2126
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000196
Family Spectrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019464   Gene: ENSCSAVG00000011411   Transcript: ENSCSAVT00000019674
Sequence length 2302
Comment pep:novel reftig:CSAV2.0:reftig_1:4529404:4568003:-1 gene:ENSCSAVG00000011411 transcript:ENSCSAVT00000019674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQVQRNAPDYADDESYDMEEFIDKRWVDVEFEEEETDLDNSSARLFERSRIKALADEREA
VQKKTFTKWVNSHLVRVSCRIQDLYMDLRDGRSLIKLLEILSGERLPKPTRGKMRIHCLE
NTGKALQFLKSKKVHLENMGPHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNRETRS
AKDALLLWCQMKTAGYANVNVHNFNTSWRDGLAFNAIIHKHRPDLIDYDSLKKSNAMHNL
QNAFNVAEQQLGLTKLLDPEDIVVERPDEKSIITYVVTYYHYFSKMKAIAVEGKRIGKVL
DSALESNQMVEKYDSLASDLLDWIEQTIEILNDRTFANSLSGVSAQLAAFNNYRTAEKPQ
KFQEKGNLEVLLFTLQSKMRANNQKPYLPKEGKLVSDINKAWEKLEKAEHGRELAIRNEL
IRQERLELLASRFDRKAAMRETWLSENQKLVTQDNFGGDLPAVEAATKKHEAIETDVKAY
EERVQAVVDVASELQREDYHDITRVNQRKDNVLQLWEYLLELLQGRRTRLELNVRLQQMF
EEMMSLLDWMDDMKGQLANEDLGQHLMGVEDILQKHMLLEQDITVHGDRVKAIESQSQEF
LQPTNDYSACEPSAVEDKVVGVRTTYDQLCKQAADRRAKLDESRRMHLFFATMAEEVAWV
KEKEQLLNSDDLGRDLTSVHSLLTKQKALEDEMNGRKAMLANAIAVGEDLISEDHFASQD
IAKHISDINEQWKNLEELAEARNELLKESKQTLPVIFYADTDDVDTWLVDMFRIVSTDDC
GRDEPSVLSLLKKHAQVQEELTKYEGVIKALHDEADGLTEKDRESVEVQERLRSVDSRYK
ELLDFAKLRKEKLIDARALYKFYGEADTISAWIAEKEQVLENMLVPDNIEDMELVQHRFE
GYENEVNKLAPQVAVVNQMARGLVQTQHPNSDDVSAKQNELNARWNALRALLEERREILA
SAKGLHGFKLECDETEGWIKDKARVLAAGAEDQLSDRDLAGVVALQRKLSSMELDLAAIQ
AKLDNLRDEADRLSNEHPEEADEIRKKFEQMERVWQELRDMLRQREDSLGEAGNLQKFLR
DLDRFQAWLSTTQTTIASEDMPQSLPEAEKLLQQHQAIKLEIDNYQADYEEIKSTGAQVT
SGREDEPQYMFLGQRLQALDQGWIELHKMWENRNHFLNEAKEYQAFIRDCKQAEQILTNQ
EYALESARRSSAAASTPDSAEEVMKKHEAFVATMASADERVEAVLRDAGKLADADHHAAD
KIKERAEKIAERRAKNKEEAGEVSTMLRDNLALQKFVADCDELSEWVNEKMLTAKDATYD
DARNLHSKWQKHQAFSAELTANKDRLERLEEDGSTLAKSKPEWKDQIDVRLDDLRKHWEA
LESCTKTKEKTLFEANKAELFSQTCEDLEKFASMMEEQLNSDDVGKDLASVNVLLKDHLA
QQDEIEVRKQEVQELESQVLRSEGDEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENSK
QLHQFYRDVQDEKLWIDEKHPQATSNELGNSLQEVQALQKKHQALRSELTAHEPVVVAVC
HRGVAMATEDNPNTDKINEKCHELQENWNRLLEDVDERKRKLSEAENAQQYFFDADEAVV
LMEEQELYMMSDEKAKDSQGATKMLKKHQAQEQNIDDFADTIQQLSKTCRDLCEQEHPQS
EQLSTRQQQVDQTYAGLKDLAEERRMKLRERCDLFRLSRDIDDLEQWIAQREVVAASQEQ
GQDFDHVSMLQDQFNDFQRDTIKTGEERVADAMRMSDELINAGHTDAQDIAGWKDTIRDA
WADLLELIDTRVEMLAAAYALHKFHYDAAEILARIQEKRQEVPEELGRDHDAVENFKREH
DIFAQDIKAIGAQVEAITSAGSELEGRYAGDDLQEIQKKIEAVLSAWNNLLSLVKKRAAL
LSDALNKFRFFNMCRDLMDWMESTVRQIDLQEKPRDVSGVETAMSLHQGTKAEIDARNGS
FEECTQLGQHLITTGHYASDEIRVKLDELGAKRNHVVDRWQEKWELNLLMEVYQFAHDAN
TCDAWVQQQLGLIRDMPVDTCRSADDADQLLRRLDGFEKAAVPWEDRFAALEKLTEEEQE
KKRKEEEEQEERRRKAEEDEQKIKKEAELEAARVQAIVDAENPKIQNVNPEESFNMTPIA
GPTVPLTPRRRDLLPSPIMSSTPSGAQYTQTPVKMRQKAPQDSESPDVPYQGFLKRKSTM
FSPSKKAPNRSWNSVFCVLQDKNLAFYKDPKAASQRASFHGEQSISLENATIEIASDYKK
RKNVLRLRLSAGMEYLFQAKDE
Download sequence
Identical sequences H2ZPE8
ENSCSAVP00000019464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]