SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019465 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019465
Domain Number 1 Region: 31-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-90
Family Calponin-homology domain, CH-domain 0.00000161
Further Details:      
 
Domain Number 2 Region: 1030-1185
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-29
Family Spectrin repeat 0.0000238
Further Details:      
 
Domain Number 3 Region: 618-755
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-28
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 4 Region: 301-430
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-28
Family Spectrin repeat 0.0000798
Further Details:      
 
Domain Number 5 Region: 1852-2001
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 833-967
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-26
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 1247-1400
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-25
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 8 Region: 1743-1897
Classification Level Classification E-value
Superfamily Spectrin repeat 3.64e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 9 Region: 440-539
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 10 Region: 1585-1686
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-19
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 11 Region: 764-864
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-19
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 12 Region: 544-651
Classification Level Classification E-value
Superfamily Spectrin repeat 9.44e-18
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 13 Region: 1466-1560
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000331
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 14 Region: 2007-2072
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000114
Family Spectrin repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019465
Domain Number - Region: 1409-1494
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0331
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019465   Gene: ENSCSAVG00000011411   Transcript: ENSCSAVT00000019675
Sequence length 2097
Comment pep:novel reftig:CSAV2.0:reftig_1:4533327:4567994:-1 gene:ENSCSAVG00000011411 transcript:ENSCSAVT00000019675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRNAPDYADDESYDMEEFIDKRWVDVEFEEEETDLDNSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLVRVSCRIQDLYMDLRDGRSLIKLLEILSGERLPKPTRGKMRIHCLENTG
KALQFLKSKKVHLENMGPHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNRETRSAKD
ALLLWCQMKTAGYANVNVHNFNTSWRDGLAFNAIIHKHRPDLIDYDSLKKSNAMHNLQNA
FNVAEQQLGLTKLLDPEDIVVERPDEKSIITYVVTYYHYFSKMKAIAVEGKRIGKVLDSA
LESNQMVEKYDSLASDLLDWIEQTIEILNDRTFANSLSGVSAQLAAFNNYRTAEKPQKFQ
EKGNLEVLLFTLQSKMRANNQKPYLPKEGKLVSDINKVSLRICRKTEFAWEKLEKAEHGR
ELAIRNELIRQERLELLASRFDRKAAMRETWLSENQKLVTQDNFGGDLPAVEAATKKHEA
IETDVKAYEERVQAVVDVASELQREDYHDITRVNQRKDNVLQLWEYLLELLQGRRTRLEL
NVRLQQMFEEMMSLLDWMDDMKGQLANEDLGQHLMGVEDILQKHMLLEQDITVHGDRVKA
IESQSQEFLQPTNDYSACEPSAVEDKVVGVRTTYDQLCKQAADRRAKLDESRRMHLFFAT
MAEEVAWVKEKEQLLNSDDLGRDLTSVHSLLTKQKALEDEMNGRKAMLANAIAVGEDLIS
EDHFASQDIAKHISDINEQWKNLEELAEARNELLKESKQTLPVIFYADTDDVDTWLVDMF
RIVSTDDCGRDEPSVLSLLKKHAQVQEELTKYEGVIKALHDEADGLTEKDRESVEVQERL
RSVDSRYKELLDFAKLRKEKLIDARALYKFYGEADTISAWIAEKEQVLENMLVPDNIEDM
ELVQHRFEGYENEVNKLAPQVAVVNQMARGLVQTQHPNSDDVSAKQNELNARWNALRALL
EERREILASAKGLHGFKLECDETEGWIKDKARVLAAGAEDQLSDRDLAGVVALQRKLSSM
ELDLAAIQAKLDNLRDEADRLSNEHPEEADEIRKKFEQMERVWQELRDMLRQREDSLGEA
GNLQKFLRDLDRFQAWLSTTQTTIASEDMPQSLPEAEKLLQQHQAIKLEIDNYQADYEEI
KSTGAQVTSGREDEPQYMFLGQRLQALDQGWIELHKMWENRNHFLNEAKEYQAFIRDCKQ
AEQILTNQEYALESARRSSAAASTPDSAEEVMKKHEAFVATMASADERVEAVLRDAGKLA
DADHHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDNLALQKFVADCDELSEWVNEKML
TAKDATYDDARNLHSKWQKHQAFSAELTANKDRLERLEEDGSTLAKSKPEWKDQIDVRLD
DLRKHWEALESCTKTKEKTLFEANKAELFSQTCEDLEKFASMMEEQLNSDDVGKDLASVN
VLLKDHLAQQDEIEVRKQEVQELESQVLRSEGDEDVDTMNEERAKIKHRIEDLDEPLTKR
KDALENSKQLHQFYRDVQDEKLWIDEKHPQATSNELGNSLQEVQALQKKHQVTHRSRAGR
GCRVPSLLEDVDERKRKLSEAENAQQYFFDADEAVVLMEEQELYMMSDEKAKDSQGATKM
LKKHQAQEQNIDDFADTIQQLSKTCRDLCEQEHPQSEQLSTRQQQVDQTYAGLKDLAEER
RMKLRERCDLFRLSRDIDDLEQWIAQREVVAASQEQGQDFDHVSMLQDQFNDFQRDTIKT
GEERVADAMRMSDELINAGHTDAQDIAGWKDTIRDAWADLLELIDTRVEMLAAAYALHKF
HYDAAEILARIQEKRQEVPEELGRDHDAVENFKREHDIFAQDIKAIGAQVEAITSAGSEL
EGRYAGDDLQEIQKKIEAVLSAWNNLLSLVKKRAALLSDALNKFRFFNMCRDLMDWMEST
VRQIDLQEKPRDVSGVETAMSLHQGTKAEIDARNGSFEECTQLGQHLITTGHYASDEIRV
KLDELGAKRNHVVDRWQEKWELNLLMEVYQFAHDANTCDAWVQQQLGLIRDMPVDTCRSA
DDADQLLRRLDGFEKAAVPWEDRFAALEKLTEMKSHEGMLQRKQERDADGRKASNRS
Download sequence
Identical sequences H2ZPE9
ENSCSAVP00000019465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]