SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019466 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019466
Domain Number 1 Region: 31-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-90
Family Calponin-homology domain, CH-domain 0.00000161
Further Details:      
 
Domain Number 2 Region: 301-419
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-33
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 3 Region: 1458-1602
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-28
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 607-744
Classification Level Classification E-value
Superfamily Spectrin repeat 2.66e-28
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 5 Region: 1019-1170
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-28
Family Spectrin repeat 0.0000286
Further Details:      
 
Domain Number 6 Region: 908-1067
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-28
Family Spectrin repeat 0.00083
Further Details:      
 
Domain Number 7 Region: 1872-2022
Classification Level Classification E-value
Superfamily Spectrin repeat 8.04e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1236-1389
Classification Level Classification E-value
Superfamily Spectrin repeat 1.64e-25
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 9 Region: 429-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 10 Region: 1558-1693
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-20
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 11 Region: 753-853
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 12 Region: 1766-1884
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-18
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 13 Region: 533-640
Classification Level Classification E-value
Superfamily Spectrin repeat 9.44e-18
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 14 Region: 1659-1761
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000834
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 2030-2092
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000314
Family Spectrin repeat 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019466
Domain Number - Region: 1398-1486
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019466   Gene: ENSCSAVG00000011411   Transcript: ENSCSAVT00000019676
Sequence length 2094
Comment pep:novel reftig:CSAV2.0:reftig_1:4534504:4567994:-1 gene:ENSCSAVG00000011411 transcript:ENSCSAVT00000019676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRNAPDYADDESYDMEEFIDKRWVDVEFEEEETDLDNSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLVRVSCRIQDLYMDLRDGRSLIKLLEILSGERLPKPTRGKMRIHCLENTG
KALQFLKSKKVHLENMGPHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNRETRSAKD
ALLLWCQMKTAGYANVNVHNFNTSWRDGLAFNAIIHKHRPDLIDYDSLKKSNAMHNLQNA
FNVAEQQLGLTKLLDPEDIVVERPDEKSIITYVVTYYHYFSKMKAIAVEGKRIGKVLDSA
LESNQMVEKYDSLASDLLDWIEQTIEILNDRTFANSLSGVSAQLAAFNNYRTAEKPQKFQ
EKGNLEVLLFTLQSKMRANNQKPYLPKEGKLVSDINKAWEKLEKAEHGRELAIRNELIRQ
ERLELLASRFDRKAAMRETWLSENQKLVTQDNFGGDLPAVEAATKKHEAIETDVKAYEER
VQAVVDVASELQREDYHDITRVNQRKDNVLQLWEYLLELLQGRRTRLELNVRLQQMFEEM
MSLLDWMDDMKGQLANEDLGQHLMGVEDILQKHMLLEQDITVHGDRVKAIESQSQEFLQP
TNDYSACEPSAVEDKVVGVRTTYDQLCKQAADRRAKLDESRRMHLFFATMAEEVAWVKEK
EQLLNSDDLGRDLTSVHSLLTKQKALEDEMNGRKAMLANAIAVGEDLISEDHFASQDIAK
HISDINEQWKNLEELAEARNELLKESKQTLPVLFYADTDDVDTWLVDMFRIVSTDDCGRD
EPSVLSLLKKHAQVQEELTKYEGVIKALHDEADGLTEKDRESVEVQERLRSVDSRYKELL
DFAKLRKEKLIDARALYKFYGEADTISAWIAEKEQVLENMLVPDNIEDMELVQHRFEGYE
NEVNKLAPQVAVVNQMARGLVQTQHPNSDDVSAKQNELNARWNALRALLEERREILASAK
GLHGFKLECDETEGWIKDKARVLAAGAEDQLSDRDLAGVVALQRKLSSMELDLAAIQAKL
DNLRDEADRLSNEHPEEADEIRKKFEQMERVWQELRDMLRQREDSLGEAGNLQKFLRDLD
RFQAWLSTTQTTIASEDMPQSLPEAEKLLQQHQAIKLEIDNYQADYEEIKSTGAQVTSGR
EDEPQYMFLGQRLQALDQGWIELHKMWENRNHFLNEAKEYQAFIRDCKQAEQILTNQEYA
LESARRSSAAASTPDSAEEVMKKHEAFVATMASADERVEAVLRDAGKLADADHHAADKIK
ERAEKIAERRAKNKEEAGEVSTMLRDNLALQKFVADCDELSEWVNEKMLTAKDATYDDAR
NLHSKWQKHQAFSAELTANKDRLERLEEDGSTLAKSKPEWKDQIDVRLDDLRKHWEALES
CTKTKEKTLFEANKAELFSQTCEDLEKFASMMEEQLNSDDVGKDLASVNVLLKDHLAQQD
EIEVRKQEVQELESQAAVLRSEGDEDVDTMNEERAKIKHRIEDLDEPLTKRKDALENSKQ
LHQFYRDVQDEKLWIDEKHPQATSNELGNSLQEVQALQKKHQALRSELTAHEPVVVAVCH
RGVAMATEDNPNTDKINEKCHELQENWNRLLEDVDERKRKLSEAENAQQYFFDADEAVVL
MEEQELYMMSDEKAKDSQGATKMLKKHQAQEQNIDDFADTIQQLSKTCRDLCEQEHPQSE
QLSTRQQQVDQTYAGLKDLAEERRMKLRERCDLFRLSRDIDDLEQWIAQREVVAASQEQG
QDFDHVSMLQDQFNDFQRDTIKTGEERVADAMRMSDELINAGHTDAQDIAGWKDTIRDAW
ADLLELIDTRVEMLAAAYALHKFHYDAAEILARIQEKRQEVPEELGRDHDAVENFKREHD
IFAQDIKAIGAQVEAITSAGSELEGRYAGDDLQEIQKKIEAVLSAWNNLLSLVKKRAALL
SDALNKFRFFNMCRDLMDWMESTVRQIDLQEKPRDVSGVETAMSLHQGTKAEIDARNGSF
EECTQLGQHLITTGHYASDEIRVKLDELGAKRNHVVDRWQEKNLLNLLMEVYQFAHDANT
CDAWVQQQLGLIRDMPVDTCRSADDADQLLRRLDGFEKAAVPWEDRFAALEKLT
Download sequence
Identical sequences H2ZPF0
ENSCSAVP00000019466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]