SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000074 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000074
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-82
Family Calponin-homology domain, CH-domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 259-381
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-33
Family Spectrin repeat 0.00000218
Further Details:      
 
Domain Number 3 Region: 495-615
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-23
Family Spectrin repeat 0.0000178
Further Details:      
 
Domain Number 4 Region: 382-491
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-23
Family Spectrin repeat 0.00000644
Further Details:      
 
Domain Number 5 Region: 725-852
Classification Level Classification E-value
Superfamily EF-hand 2.33e-21
Family Calmodulin-like 0.042
Further Details:      
 
Domain Number 6 Region: 621-732
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000222
Family Spectrin repeat 0.0000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000074   Gene: ENSCSAVG00000000033   Transcript: ENSCSAVT00000000075
Sequence length 880
Comment pep:known reftig:CSAV2.0:reftig_219:198872:212401:-1 gene:ENSCSAVG00000000033 transcript:ENSCSAVT00000000075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDYMTQEDGWEREGLLDPAWERQQRKTFTAWCNSHLRKAGTQIEEIDEDFRNGLKLMLL
LEVISGEHLPRPDRGKMRLHKIANVNKALNFIASKGVRLVSIGAEEIVDGNTKMTLGMIW
TIILRFAIQDISVEESSAKEGLLLWCQRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRP
DLIDYNKLRKDDPLTNLQTAFEVAEKHLDIPQMLDAQELQDMAKPDERAVMTYVSCFYHA
FSGAQKAETAANRILKVLGVNQENERLMDEYERLASDLLEWIARMKPWLDDRTTDNTMEG
VQRKLDDFRDYRAKQKPPKIDEKGHLEAAYNTLQTKLRLSNRPAFMPSEGKLVSDITSAW
KGLEGAEKGYEEWLLAEMRRLERLDHLAKKFYYKAGIHEKWTVGQEENLASEEYKRASLQ
ELKALMKKHEAFESDLAAHQDRVEQIAAIAQELNDLDYHDTETINDRCRDICDEWDRLGS
ATQKRRTALENMEQILESIEQQHLEFAKRAAPFNNWMDCAKEDLEDMFIVHSMLEIRKLI
SAHGVFKDTLPDAQKEKESIIALVQNIKKIQRQYDLPDESCENAYTTVTPEEIESKWNVV
RNMVPARDASLQAELGKQQNHELLRTEFAQIANQFGPWMVEFTKEINRIAMSMVGSLEDV
KNSLMDYQQRMMANKPQLDTLEKKHQQMQEALVFDNPHSAYSMESLHASWEHIKALLSLT
INEVENQILMRDAKGLTQEQMNEFRASFNHFDRKRKGCLEPDDFAAVLISMGYRLGEAEF
QRIMALVDPSGTNTVTFQSFIEFMTRESTDSDTAEQVVESFRILAGDKPYITADELRREL
PPDQADYCISRMSRYSSSDAPPDALDYASFSTALYGESDL
Download sequence
Identical sequences H2Y426
ENSCSAVP00000000074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]