SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000134 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000134
Domain Number 1 Region: 79-90,209-247,290-491
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-49
Family Nuclear receptor ligand-binding domain 0.00000714
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.52e-29
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000134   Gene: ENSCSAVG00000000069   Transcript: ENSCSAVT00000000135
Sequence length 496
Comment pep:novel reftig:CSAV2.0:reftig_23:254016:264819:-1 gene:ENSCSAVG00000000069 transcript:ENSCSAVT00000000135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYSFDEACPVCGDKVSGYHYGLLTCESCKGFFKRTVQNGKKYTCVHTSKCHIDKDQRKG
CQACRFQKCLRVGMKLEAVRRDRVRGGRNKFGPLYKQDRARKQRLKAMGEVPSTSSVDDV
TLEIPRLETCEPLPLTQTPMLSGNTAGTSHEPHWDNTVLEPSSTSIMSVLPPQYNPHSPS
QNESDLGSTGDLTTHNLPAGSYIETQSFLPHSEPLQPHYPLLWGTHPAINPIPPTYFRMG
PIPNPYQILPFNTPIEGFQRGFYVPPLINELLKYEMVESEIKSRVNAAMLDDNCCSDVFN
FICKIADQTLYATVEWAKKSAFFADLQVSDQMKLLQDSWIELLILDHIQRQVKVKSDAVE
MVTGHKFPRDVSRVSGHCVITFRILKRLMDLDKKFMLLDVDEQEVACLKYLVLFDTESRT
AGCDNVQEKVNSALCEYAKKNYMEQPDRVNKLIFRLSEIRALSSQIEDYLHYKHHEGKLP
EGSLLVELLKARENGS
Download sequence
Identical sequences H2Y486
ENSCSAVP00000000134 51511.ENSCSAVP00000000134 ENSCSAVP00000000134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]