SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000945 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000945
Domain Number 1 Region: 1707-1733,1798-1923
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-32
Family Ankyrin repeat 0.00000337
Further Details:      
 
Domain Number 2 Region: 296-430
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000445
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 753-886
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 4 Region: 488-617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000385
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 687-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000357
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 650-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000544
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 152-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000142
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 8 Region: 184-313
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000151
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 1067-1201
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 10 Region: 425-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000036
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 11 Region: 918-955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000911
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 880-922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 13 Region: 609-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 14 Region: 1038-1080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000401
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 15 Region: 115-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 16 Region: 957-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000536
Family EGF-type module 0.019
Further Details:      
 
Domain Number 17 Region: 1197-1242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 1329-1361
Classification Level Classification E-value
Superfamily Notch domain 0.000000366
Family Notch domain 0.0045
Further Details:      
 
Domain Number 19 Region: 72-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.03
Further Details:      
 
Domain Number 20 Region: 2-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000577
Family EGF-type module 0.019
Further Details:      
 
Domain Number 21 Region: 1011-1047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000982
Family EGF-type module 0.028
Further Details:      
 
Domain Number 22 Region: 1371-1400
Classification Level Classification E-value
Superfamily Notch domain 0.0000116
Family Notch domain 0.0029
Further Details:      
 
Domain Number 23 Region: 36-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000232
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000945
Domain Number - Region: 1245-1277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000606
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1304-1319
Classification Level Classification E-value
Superfamily Notch domain 0.017
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000945   Gene: ENSCSAVG00000000533   Transcript: ENSCSAVT00000000955
Sequence length 2304
Comment pep:known reftig:CSAV2.0:reftig_235:7459:37449:-1 gene:ENSCSAVG00000000533 transcript:ENSCSAVT00000000955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHCLNGGTCHTSIEAGQVVRMCACPFAYTGSTCEVPISSCEEADCVNGECEIRSGTAVCV
CEQGFTGSRCNQVDYCYTNPCKNGANCTNRPLQFVCHCTANWFGATCQNFRSPSTPCTPD
PCVNSGTCVEKSTTEHQCVCLPGFEGVNCEIDIDDCEGDPCHNGATCIDQANSALCQCTD
GWTGATCDVDVDECMLNPTACLNGGTCVNTEGSYQCTCVNGWTGDDCSENVDDCASKPCF
FQGTCVDYVGTFKCICPPGKTGLLCHMDNACEETPPPCAAWAQCEINPLTGTAICTCPEG
YTGVNCSLDLNECDLGTNPCEYGGTCQNLPGTYECQCAPGFTGPRCEVNINECESNPCVN
DATCLDKIGKFLCLCMPGYTGMTCSEEINECSANPCDYGGECIDHINSYTCNCAAGYTGK
NCEININDCASTPCQNHIQCVDGVNDYSCVCKAGYDGKNCENDIDDCATSPCHYGTCVDG
INRYTCNCQLGYGGSLCDSPINECDSTPCQNGGTCHDLVASYSCDCPLGTSGTNCEINIQ
ECASSPCQHGQCIDGINKYTCDCDPGYTGLHCEADIDECLSDPCYNGGTCINNLNSFVCH
CPAGYNDPRCYSNINECTSNPCQNGFCHDDINKYVCECNAGYEGVNCEYNIDECESKPCL
NGASCVDHVDSYSCTCRPGYKGVNCETDIDECHQSPCLNGGSCANLIGRYVCTCLLGFTG
TDCETALTPCDPQPCNNGGSCHPNADYLGYSCTCTEGFQGPTCANDINECMTPPCKNGGK
CRNLEPGYLCDCLDGYTGTNCETNIDDCHPDPCMNGGTCLDDVNSYKCLCKRGFDGGQCQ
NDVDECASGPCQNGATCTEYVNSYACTCQPGFRGSTCNENINECITGSCLNGGSCVDGIN
SYSCNCVAGFTGNNCERDIDECSSSPCQNGAPCLHGIDTFTCQCLTGYTGPTCAQLVNLC
QPNPCNNGGQCSQTGTTFMCVCTSGYTGVYCDVPRMSCAAAAASRGVEETQLCQHNGQCI
NRGSTHYCSCSTGYVGSYCETDFDDCASYPCKNGATCTDYPGSYTCTCVDGFVGTDCATE
LNECSSDPCLHNGQCVDLVNSYKCLCQVGTSGDRCQDNENDCTPTSCLNSGSCVDGIGGF
TCNCVPGYAGPSENRDVNECSPNPCNPDGSTNCIQGINTFTCTCKQGFTGGRCEKQLTSC
STMPCLNGATCTDATYEPTGYRCTCPTGYRGTNCDEVMSKCHDGLVCYNGGTCHESSSGG
EICMCPADYNGDNCIYYIPGQPAGVGTNDISIPNVISKQRELQSKCNTYGCEYDGGDCSF
GIADPWDKCPQTLQCQKYFHDGMCDEACNNADCLFDGFDCEDAQEACQSGFLEYCDRNYK
NGQCDSGCNTQGCGWDGLDCDKDRPEQLAVGELILIVLISPEELIARQAEFMRLIGTIIH
SVVQFKLTPTGEPFIEAIPSTKVIEIDRSMFGNRTHTRLRRASDSFFSRAHLIVDTQKCK
ETSDQCVQATDNAASLIAARAGTNTLEATFPISTVDSSTSTTTASQDYTYIVGAAGGVVI
VIVIIAVLTHRKRKRETSTLWSPEGFMVKKQRREPIGQADFNLKMNGGIHPGELTQLDSS
NTPFLNRWDNGSLPQKANLYHVADTPENITFLPGSTPVTNSTNRDDMETLDNRKWTPQHL
EAADLEGVRLAPQSPNSPRPPLGDEDDVNARGPDGVTPLMIASIRGGGVDAGVSDDESQH
SGDAGGNGEGTNPKNNQLNFLKRPSKPQKQPTKLFKIPKQTPKTPIHPKQNQLTPHPTTN
DGTTPMILAARLAVEGMVEELINANADVNAVDDHGKSALHWAAAVNNVDAMTTLLRAGCN
RDAQTEREETPLFLASKEGSYEAIRILLDHYANRDITDHMDRLPRDIAQERLHTDIVQLL
DEYNLVRSPPIPSGHMTSHMNGHALMSRDPYLASQMKPHAGKKPRRQSNRADGKASRRVK
KTPASQGPPSSVATADSATPVVGETPPNMGLHPGMPHIGESTLSPGNNSLPSPATTYSTD
STLSPPSSMGPPSNGSFHPHLHPHPHGGIPHQFRYGDYILGCHHSFSSMMYNAVMDPSGA
HHPSQLAAYRSLGYPEQPNNRMDSASSDQRRFVDDGIQINRGYTLPTSHPHAGYNTVQVI
SQTQPISSAGQTPPAQSVSRNTPLSPIFAGTLQGYNNVLEKYPTPPSAHMSPSSGSENLS
PPGPHITHNPKHVLHDYSYETPSPDSPDPWSSSSPRSNSDWSEGIRSPTDPMPGHHHQAP
HPQHQRMRVFPPQNTGAAIAGKMG
Download sequence
Identical sequences H2Y6J7
ENSCSAVP00000000945 ENSCSAVP00000000945 51511.ENSCSAVP00000000945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]