SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000946 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000946
Domain Number 1 Region: 1776-1802,1867-1992
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-32
Family Ankyrin repeat 0.00000337
Further Details:      
 
Domain Number 2 Region: 357-491
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000115
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 814-947
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000361
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 4 Region: 749-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000339
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 5 Region: 711-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000594
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 6 Region: 1128-1262
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000753
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 7 Region: 562-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000125
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 213-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000152
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 9 Region: 636-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000304
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 10 Region: 486-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000464
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 11 Region: 979-1016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000005
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 245-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000549
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 13 Region: 941-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000977
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 14 Region: 670-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000177
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 15 Region: 1099-1141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000351
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 16 Region: 593-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 17 Region: 175-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 18 Region: 1018-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.019
Further Details:      
 
Domain Number 19 Region: 1258-1303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.011
Further Details:      
 
Domain Number 20 Region: 132-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.023
Further Details:      
 
Domain Number 21 Region: 1402-1434
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0045
Further Details:      
 
Domain Number 22 Region: 15-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000407
Family EGF-type module 0.012
Further Details:      
 
Domain Number 23 Region: 91-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000838
Family EGF-type module 0.029
Further Details:      
 
Domain Number 24 Region: 1360-1392
Classification Level Classification E-value
Superfamily Notch domain 0.00000248
Family Notch domain 0.0017
Further Details:      
 
Domain Number 25 Region: 521-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 26 Region: 1072-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000857
Family EGF-type module 0.028
Further Details:      
 
Domain Number 27 Region: 789-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000923
Family EGF-type module 0.016
Further Details:      
 
Domain Number 28 Region: 1444-1473
Classification Level Classification E-value
Superfamily Notch domain 0.00000994
Family Notch domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000946
Domain Number - Region: 55-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1301-1338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000408
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000946   Gene: ENSCSAVG00000000533   Transcript: ENSCSAVT00000000956
Sequence length 2016
Comment pep:known reftig:CSAV2.0:reftig_235:10771:37506:-1 gene:ENSCSAVG00000000533 transcript:ENSCSAVT00000000956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRTGYGGATCNVDDSSCDASHCLNGGTCHTSIEAGQVVRMCACPFAYTGSTCEVPISSCE
EADCVNGECEIRSGTAVCVCEQGFTGSRCNQVDYCYTNPCKNGANCTNRPLQFVCHCTAN
WFGATCQNFRSPCGAVRNICKNKGVCESAEDHYYCVCPNGFTGAHCESEVLRKSSTPCTP
DPCVNSGTCVEKSTTEHQCVCLPGFEGVNCEIDIDDCEGDPCHNGATCIDQANSALCQCT
DGWTGATCDVDVDECMLNPTACLNGGTCVNTEGSYQCTCVNGWTGDDCSENVDDCASKPC
FFQGTCVDYVGTFKCICPPGKTGLLCHMDNACEETPPPCAAWAQCEINPLTGTAICTCPE
GYTGVNCSLDLNECDLGTNPCEYGGTCQNLPGTYECQCAPGFTGPRCEVNINECESNPCV
NDATCLDKIGKFLCLCMPGYTGMTCSEEINECSANPCDYGGECIDHINSYTCNCAAGYTG
KNCEININDCASTPCQNHIQCVDGVNDYSCVCKAGYDGKNCENDIDDCATSPCHYGTCVD
GINRYTCNCQLGYGGSLCDSPINECDSTPCQNGGTCHDLVASYSCDCPLGTSGTNCEINI
QECASSPCQHGQCIDGINKYTCDCDPGYTGLHCEADIDECLSDPCYNGGTCINNLNSFVC
HCPAGYNDPRCYSNINECTSNPCQNGFCHDDINKYVCECNAGYEGVNCEYNIDECESKPC
LNGASCVDHVDSYSCTCRPGYKGVNCETDIDECHQSPCLNGGSCANLIGRYVCTCLLGFT
GTDCETALTPCDPQPCNNGGSCHPNADYLGYSCTCTEGFQGPTCANDINECMTPPCKNGG
KCRNLEPGYLCDCLDGYTGTNCETNIDDCHPDPCMNGGTCLDDVNSYKCLCKRGFDGGQC
QNDVDECASGPCQNGATCTEYVNSYACTCQPGFRGSTCNENINECITGSCLNGGSCVDGI
NSYSCNCVAGFTGNNCERDIDECSSSPCQNGAPCLHGIDTFTCQCLTGYTGPTCAQLVNL
CQPNPCNNGGQCSQTGTTFMCVCTSGYTGVYCDVPRMSCAAAAASRGVEETQLCQHNGQC
INRGSTHYCSCSTGYVGSYCETDFDDCASYPCKNGATCTDYPGSYTCTCVDGFVGTDCAT
ELNECSSDPCLHNGQCVDLVNSYKCLCQVGTSGDRCQDNENDCTPTSCLNSGSCVDGIGG
FTCNCVPGYAGPSENRDVNECSPNPCNPDGSTNCIQGINTFTCTCKQGFTGGRCEKQLTS
CSTMPCLNGATCTDATYEPTGYRCTCPTGYRGTNCDEVMSKCHDGLVCYNGGTCHESSSG
GEICMCPADYNGDNCIYYIPGQPAGVGTNDISIPNVITKVCMDPSCAALKGNKECDSKCN
TYGCEYDGGDCSFGIADPWDKCPQTLQCQKYFHDGMCDEACNNADCLFDGFDCEDAQEAC
QSGFLEYCDRNYKNGQCDSGCNTQGCGWDGLDCDKDRPEQLAVGELILIVLISPEELIAR
QAEFMRLIGTIIHSVVQFKLTPTGEPFIEAIPSTVVIEIDRSMFGNRTHTRLRRASDSFF
SRVGAHLIVDTQKCKETSDQCVQATDNAASLIAARAGTNTLEATFPISTVDSSTSTTTAS
QDYTYIVGAAGGVVIVIVIIAVLTHRKRKRETSTLWSPEGFMVKKQRREPIGQADFNLKM
NGGIHPGELTQLDSSNTPFLNRWDNGSLPQKANLYHNNGYQGSTPVTNSTNRDDMETLDN
RKWTPQHLEAADLPRGGSACTPVTELTPPTTGDEDDVNARGPDGVTPLMIASIRGGGVDA
GVSDDESQHSGDAGGNGEGTNPKNNQLNFLKRPSKPQKQPTKLFKIPKQTPKTPIHPKQN
QLTPPNRTNDGTTPMILAARLAVEGMVEELINANADVNAVDDHGKSALHWAAAVNNVDAM
TTLLRAGCNRDAQTEREETPLFLASKEGSYEAIRILLDHYANRDITDHMDRLPRDIAQER
LHTDIVQLLDEYNLVRSPPIPSGHMTSHMNGHALMS
Download sequence
Identical sequences H2Y6J8
ENSCSAVP00000000946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]