SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000947 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000947
Domain Number 1 Region: 1649-1675,1740-1865
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-32
Family Ankyrin repeat 0.00000337
Further Details:      
 
Domain Number 2 Region: 537-666
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000013
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 854-895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000447
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 4 Region: 815-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000613
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 699-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000753
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 6 Region: 1011-1145
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000105
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 7 Region: 930-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000143
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 234-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 9 Region: 443-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000331
Family EGF-type module 0.0018
Further Details:      
 
Domain Number 10 Region: 968-1007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000365
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 11 Region: 892-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 12 Region: 658-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 13 Region: 736-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 14 Region: 389-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000439
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 15 Region: 272-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 16 Region: 196-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 17 Region: 153-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000005
Family EGF-type module 0.018
Further Details:      
 
Domain Number 18 Region: 1141-1186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.011
Further Details:      
 
Domain Number 19 Region: 1285-1317
Classification Level Classification E-value
Superfamily Notch domain 0.000000288
Family Notch domain 0.0045
Further Details:      
 
Domain Number 20 Region: 15-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000407
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 112-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000008
Family EGF-type module 0.029
Further Details:      
 
Domain Number 22 Region: 777-821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000839
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 23 Region: 312-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 24 Region: 1243-1275
Classification Level Classification E-value
Superfamily Notch domain 0.00000235
Family Notch domain 0.0017
Further Details:      
 
Domain Number 25 Region: 1327-1356
Classification Level Classification E-value
Superfamily Notch domain 0.00000915
Family Notch domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000947
Domain Number - Region: 1184-1221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000373
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 55-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000911
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000947   Gene: ENSCSAVG00000000533   Transcript: ENSCSAVT00000000957
Sequence length 1878
Comment pep:known reftig:CSAV2.0:reftig_235:10804:37506:-1 gene:ENSCSAVG00000000533 transcript:ENSCSAVT00000000957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRTGYGGATCNVDDSSCDASHCLNGGTCHTSIEAGQVVRMCACPFAYTGSTCEVPISSCE
EADCVNGECEIRSGTAVCVCEQGFTGKPTVLVLIIFTFLHFSMKIPGSRCNQVDYCYTNP
CKNGANCTNRPLQFVCHCTANWFGATCQNFRSPCGAVRNICKNKGVCESAEDHYYCVCPN
GFTGAHCESEVLRKSSTPCTPDPCVNSGTCVEKSTTEHQCVCLPGFEGVNCEIDIDDCEG
DPCHNGATCIDQANSALCQCTDGWTGATCDVDVDECMLNPTACLNGGTCVNTEGSYQCTC
VNGWTGDDCSENVDDCASKPCFFQGTCVDYVGTFKCICPPGKTAIYFFLVKLIVIDIFLS
SKKCSRIFHASYQGFGWTNYKTIHVVIKCPAKYFVRLLCHMDNACEETPPPCAAWAQCEI
NPLTGTAICTCPEGYTGVNCSLDLNECDLGTNPCEYGGTCQNLPGTYECQCAPGFTGPRC
EVNINECESNPCVNDATCLDKIGKFLCLCMPGDSIPRMKSTQSPNIFRQPRRYTCNCQLG
YGGSLCDSPINECDSTPCQNGGTCHDLVASYSCDCPLGTSGTNCEINIQECASSPCQHGQ
CIDGINKYTCDCDPGYTGLHCEADIDECLSDPCYNGGTCINNLNSFVCHCPAGYNDPRCY
SNINECTSNPCQNGFCHDDINKYVCECNAGYEGVNCEYNIDECESKPCLNGASCVDHVDS
YSCTCRPGYKGVNCETDIDECHQSPCLNGGSCANLIGRYVCTCLLGFTGKWNCETALTPC
DPQPCNNGGSCHPNADYLGYSCTCTEGFQGPTCANDINECMTPPCKNGGKCRNLEPGYLC
DCLDGYTGTNCETNIDDCHPDPCMNGGTCLDDVNSYKCLCKRGFDGGQCQNDVDECASGP
CQNGATCTEYVNSYACTCQPGFRGSTCNENINECITGSCLNGGSCVDGINSYSCNCVAGF
TGNNCERDIDECSSSPCQNGAPCLHGIDTFTCQCLTGYTGPTCAMNIYTCTCVDGFVGTD
CATELNECSSDPCLHNGQCVDLVNSYKCLCQVGTSGDRCQDNENDCTPTSCLNSGSCVDG
IGGFTCNCVPGYAGPSENRDVNECSPNPCNPDGSTNCIQGINTFTCTCKQGFTGGRCEKQ
LTSCSTMPCLNGATCTDATYEPTGYRCTCPTGYRGTNCDEVMSKCHDGLVCYNGGTCHES
SSGGEICMCPADYNGDNCIYYIPGQPAGVGTNDISIPNVITKVCMDPSCAALKGNKECDS
KCNTYGCEYDGGDCSFGIADPWDKCPQTLQCQKYFHDGMCDEACNNADCLFDGFDCEDAQ
EACQSGFLEYCDRNYKNGQCDSGCNTQGCGWDGLDCDKDRPEQLAVGELILIVLISPEEL
IARQAEFMRLIGTIIHSVVQFKLTPTGEPFIEAIPSTLSRKRRSVLGALGWEKVIEIDRS
MFGNRTHTRLRRASDSFFSRAHLIVDTQKCKETSDQCVQATDNAASLIAARAGTNTLEAT
FPISTVDSSTSTTTASQDYTYIVGAAGGVVIVIVIIAVLTHRKRKRETSTLWSPEGFMVK
KQRREPIGQADFNLKLFPFINFICKNIFFLYFFINYFIFPQNNGYQGSTPVTNSTNRDDM
ETLDNRKWTPQHLEAADLPRGGSACTPDDVNARGPDGVTPLMIASIRGGGVDAGVSDDES
QHSGDAGGNGEGTNPKNNQLNFLKRPSKPQKQPTKLFKIPKQTPKTPIHPKQNQLTPPNR
TNDGTTPMILAARLAVEGMVEELINANADVNAVDDHGKSALHWAAAVNNVDAMTTLLRAG
CNRDAQTEREETPLFLASKEGSYEAIRILLDHYANRDITDHMDRLPRDIAQERLHTDIVQ
LLDEYNLVRSPPIPSGHM
Download sequence
Identical sequences H2Y6J9
ENSCSAVP00000000947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]