SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000948 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000948
Domain Number 1 Region: 1703-1729,1794-1919
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-32
Family Ankyrin repeat 0.00000337
Further Details:      
 
Domain Number 2 Region: 494-624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000106
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 380-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000018
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 759-892
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 5 Region: 228-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000785
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 694-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000015
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 7 Region: 196-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000173
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 8 Region: 619-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 9 Region: 1073-1208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 10 Region: 924-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000152
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 11 Region: 1044-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000336
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 653-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000606
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 13 Region: 886-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000737
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 14 Region: 158-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 15 Region: 963-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.019
Further Details:      
 
Domain Number 16 Region: 1204-1249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000136
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 115-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.023
Further Details:      
 
Domain Number 18 Region: 1362-1394
Classification Level Classification E-value
Superfamily Notch domain 0.000000301
Family Notch domain 0.0045
Further Details:      
 
Domain Number 19 Region: 74-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000719
Family EGF-type module 0.029
Further Details:      
 
Domain Number 20 Region: 1320-1352
Classification Level Classification E-value
Superfamily Notch domain 0.00000222
Family Notch domain 0.0017
Further Details:      
 
Domain Number 21 Region: 3-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000033
Family EGF-type module 0.019
Further Details:      
 
Domain Number 22 Region: 1017-1053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000804
Family EGF-type module 0.028
Further Details:      
 
Domain Number 23 Region: 734-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000904
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 1404-1433
Classification Level Classification E-value
Superfamily Notch domain 0.00000955
Family Notch domain 0.0029
Further Details:      
 
Domain Number 25 Region: 38-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000286
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000948
Domain Number - Region: 1246-1284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000317
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000948   Gene: ENSCSAVG00000000533   Transcript: ENSCSAVT00000000958
Sequence length 1930
Comment pep:known reftig:CSAV2.0:reftig_235:10810:37455:-1 gene:ENSCSAVG00000000533 transcript:ENSCSAVT00000000958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DASHCLNGGTCHTSIEAGQVVRMCACPFAYTGSTCEVPISSCEEADCVNGECEIRSGTAV
CVCEQGFTGSRCNQVDYCYTNPCKNGANCTNRPLQFVCHCTANWFGATCQNFRSPCGAVR
NICKNKGVCESAEDHYYCVCPNGFTGAHCESEVLRKSSTPCTPDPCVNSGTCVEKSTTEH
QCVCLPGFEGVNCEIDIDDCEGDPCHNGATCIDQANSALCQCTDGWTGATCDVDVDECML
NPTACLNGGTCVNTEGSYQCTCVNGWTGDDCSENVDDCASKPCFFQGTCVDYVGTFKCIC
PPGKTGLLCHMDNACEETPPPCAAWAQCEINPLTGTAICTCPEGYTGVNCSLDLNECDLG
TNPCEYGGTCQNLPGTYECQCAPGFTGPRCEVNINECESNPCVNDATCLDKIGKFLCLCM
PGYTGMTCSEEINECSANPCDYGGECIDHINSYTCNCAAGYTGKNCEININDCASTPCQN
HIQCVDGVNDYSCVCKAGYDGKNCENDIDDCATSPCHYGTCVDGINRYTCNCQLGYGGSL
CDSPINECDSTPCQNGGTCHDLVASYSCDCPLGTSGTNCEINIQECASSPCQHGQCIDGI
NKYTCDCDPGYTGLHCEADIDECLSDPCYNGGTCINNLNSFVCHCPAGYNDPRCYSNINE
CTSNPCQNGFCHDDINKYVCECNAGYEGVNCEYNIDECESKPCLNGASCVDHVDSYSCTC
RPGYKGTDCETALTPCDPQPCNNGGSCHPNADYLGYSCTCTEGFQGPTCANDINECMTPP
CKNGGKCRNLEPGYLCDCLDGYTGTNCETNIDDCHPDPCMNGGTCLDDVNSYKCLCKRGF
DGGQCQNDVDECASGPCQNGATCTEYVNSYACTCQPGFRGSTCNENINECITGSCLNGGS
CVDGINSYSCNCVAGFTGNNCERDIDECSSSPCQNGAPCLHGIDTFTCQCLTGYTGPTCA
QLVNLCQPNPCNNGGQCSQTGTTFMCVCTSGYTGVYCDVPRMSCAAAAASRGVEETQLCQ
HNGQCINRGSTHYCSCSTGYVGSYCETDFDDCASYPCKNGATCTDYPGSYTCTCVDGFVG
TDCATELNECSSDPCLHNGQCVDLVNSYKCLCQVGTSGDRCQDNENDCTPTSCLNSGSCV
DGIGGFTCNCVPGYAGPSYLNGDVNECSPNPCNPDGSTNCIQGINTFTCTCKQGFTGGRC
EKQLTSCSTMPCLNGATCTDATYEPTGYRCTCPTGYRGTNCDEVMSKCHDGLVCYNGGTC
HESSSGGEICMCPADYNGDNCIYYIPGQPAGVGTNDISIPNVISKQRDFLNFIFIFSAKV
CMDPSCAALKGNKECDSKCNTYGCEYDGGDCSFGIADPWDKCPQTLQCQKYFHDGMCDEA
CNNADCLFDGFDCEDAQEACQSGFLEYCDRNYKNGQCDSGCNTQGCGWDGLDCDKDRPEQ
LAVGELILIVLISPEELIARQAEFMRLIGTIIHSVVQFKLTPTGEPFIEAIPSTLSRKRR
SVLGALGWEKVIEIDLDTQKCKETSDQCVQATDNAASLIAARAGTNTLEATFPISTVDSS
TSTTTASQDYTYIVGAAGGVVIVIVIIAVLTHRKRKRETSTLWSPEGFMVKKQRREPIGQ
ADFNLKYISQTTFLLHITSSDLQNNGYQGSTPVTNSTNRDDMETLDNRKWTPQHLEAADL
PRGGSACTPVTELTPPTTGDEDDVNARGPDGVTPLMIASIRGGGVDAGVSDDESQHSGDA
GGNGEGTNPKNNQLNFLKRPSKPQKQPTKLFKIPKQTPKTPIHPKQNQLTPPNRTNDGTT
PMILAARLAVEGMVEELINANADVNAVDDHGKSALHWAAAVNNVDAMTTLLRAGCNRDAQ
TEREETPLFLASKEGSYEAIRILLDHYANRDITDHMDRLPRDIAQERLHTDIVQLLDEYN
LVRSPPIPSG
Download sequence
Identical sequences H2Y6K0
ENSCSAVP00000000948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]