SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000950 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000950
Domain Number 1 Region: 1724-1750,1815-1940
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-32
Family Ankyrin repeat 0.00000337
Further Details:      
 
Domain Number 2 Region: 323-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000541
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 553-681
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000131
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 781-914
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000706
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 5 Region: 677-719
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000761
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 6 Region: 1095-1229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000121
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 7 Region: 217-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000255
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 8 Region: 440-569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000487
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 946-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000697
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 10 Region: 908-950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 11 Region: 714-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 12 Region: 179-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 13 Region: 1066-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000317
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 14 Region: 254-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000111
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 15 Region: 141-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 16 Region: 985-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000464
Family EGF-type module 0.019
Further Details:      
 
Domain Number 17 Region: 98-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000464
Family EGF-type module 0.018
Further Details:      
 
Domain Number 18 Region: 1225-1270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000104
Family EGF-type module 0.011
Further Details:      
 
Domain Number 19 Region: 1383-1415
Classification Level Classification E-value
Superfamily Notch domain 0.000000301
Family Notch domain 0.0045
Further Details:      
 
Domain Number 20 Region: 57-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.029
Further Details:      
 
Domain Number 21 Region: 1341-1373
Classification Level Classification E-value
Superfamily Notch domain 0.00000222
Family Notch domain 0.0017
Further Details:      
 
Domain Number 22 Region: 15-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000439
Family EGF-type module 0.016
Further Details:      
 
Domain Number 23 Region: 1039-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000822
Family EGF-type module 0.028
Further Details:      
 
Domain Number 24 Region: 1425-1454
Classification Level Classification E-value
Superfamily Notch domain 0.00000955
Family Notch domain 0.0029
Further Details:      
 
Domain Number 25 Region: 755-792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000559
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000950
Domain Number - Region: 298-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family Laminin-type module 0.054
Further Details:      
 
Domain Number - Region: 1268-1305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000385
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000950   Gene: ENSCSAVG00000000533   Transcript: ENSCSAVT00000000960
Sequence length 1946
Comment pep:known reftig:CSAV2.0:reftig_235:10825:37506:-1 gene:ENSCSAVG00000000533 transcript:ENSCSAVT00000000960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRTGYGGATCNVDDSSCDASHCLNGGTCHTSIEAGQIRSGTAVCVCEQGFTGSRCNQVDY
CYTNPCKNGANCTNRPLQFVCHCTANWFGATCQNFRSPCGAVRNICKNKGVCESAEDHYY
CVCPNGFTGAHCESEVLRKSSTPCTPDPCVNSGTCVEKSTTEHQCVCLPGFEGVNCEIDI
DDCEGDPCHNGATCIDQANSALCQCTDGWTGATCDVDVDECMLNPTACLNGGTCVNTEGS
YQCTCVNGWTGDDCSENVDDCASKPCFFQGTCVDYVGTFKCICPPGKTGLLCHMDNACEE
TPPPCAAWAQCEINPLTGTAICTCPEGYTGVNCSLDLNECDLGTNPCEYGGTCQNLPGTY
ECQCAPGFTGPRCEVNINECESNPCVNDATCLDKIGKFLCLCMPGYTGMTCSEEINECSA
NPCDYGGECIDHINSYTCNCAAGYTGKNCEININDCASTPCQNHIQCVDGVNDYSCVCKA
GYDGKNCENDIDDCATSPCHYGTCVDGINRYTCNCQLGYGGSLCDSPINECDSTPCQNGG
TCHDLVASYSCDCPLGTSGTNCEINIQECASSPCQHGQCIDGINKYTCDCDPGYTGLHCE
ADIDECLSDPCYNGGTCINNLNSFVCHCPAGYNDPRCYSNINECTSNPCQNGFCHDDINK
YVCECNAGYEGVNCEYNIDECESKPCLNGASCVDHVDSYSCTCRPGYKGVNCETDIDECH
QSPCLNGGSCANLIGRYVCTCLLGFTGKWNCETALTPCDPQPCNNGGSCHPNADYLGYSC
TCTEGFQGPTCANDINECMTPPCKNGGKCRNLEPGYLCDCLDGYTGTNCETNIDDCHPDP
CMNGGTCLDDVNSYKCLCKRGFDGGQCQNDVDECASGPCQNGATCTEYVNSYACTCQPGF
RGSTCNENINECITGSCLNGGSCVDGINSYSCNCVAGFTGNNCERDIDECSSSPCQNGAP
CLHGIDTFTCQCLTGYTGPTCAQLVNLCQPNPCNNGGQCSQTGTTFMCVCTSGYTGVYCD
VPRMSCAAAAASRGVEETQLCQHNGQCINRGSTHYCSCSTGYVGSYCETDFDDCASYPCK
NGATCTDYPGSYTCTCVDGFVGTDCATELNECSSDPCLHNGQCVDLVNSYKCLCQVGTSG
DRCQDNENDCTPTSCLNSGSCVDGIGGFTCNCVPGYAGPSENRDVNECSPNPCNPDGSTN
CIQGINTFTCTCKQGFTGGRCEKQLTSCSTMPCLNGATCTDATYEPTGYRCTCPTGYRGT
NCDEVMSKCHDGLVCYNGGTCHESSSGGEICMCPADYNGDNCIYYIPGQPAGVGTNDISI
PNVISKQRDFLNFIFIFSAKVCMDPSCAALKGNKECDSKCNTYGCEYDGGDCSFGIADPW
DKCPQTLQCQKYFHDGMCDEACNNADCLFDGFDCEDAQEACQSGFLEYCDRNYKNGQCDS
GCNTQGCGWDGLDCDKDRPEQLAVGELILIVLISPEELIARQAEFMRLIGTIIHSVVQFK
LTPTGEPFIEAIPSTAHLIVDTQKCKETSDQCVQATDNAASLIAARAGTNTLEATFPIST
VDSSTSTTTASQDYTYIVGAAGTRGVVIVIVIIAVLTHRKRKRETSTLWSPEGFMVKKQR
REPIGQADFNLKMNGGIHPGELTQLDSSNTPFLNRWDNGSLPQKANLYHGSTPVTNSTNR
DDMETLDNRKWTPQHLEAADLPRGGSACTPVTELTPPTTGDEDDVNARGPDGVTPLMIAS
IRGGGVDAGVSDDESQHSGDAGGNGEGTNPKNNQLNFLKRPSKPQKQPTKLFKIPKQTPK
TPIHPKQNQLTPPNRTNDGTTPMILAARLAVEGMVEELINANADVNAVDDHGKSALHWAA
AVNNVDAMTTLLRAGCNRDAQTEREETPLFLASKEGSYEAIRILLDHYANRDITDHMDRL
PRDIAQERLHTDIVQLLDEYNLVRSP
Download sequence
Identical sequences H2Y6K2
ENSCSAVP00000000950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]