SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000953 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000953
Domain Number 1 Region: 355-487
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000118
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 545-673
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000126
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 203-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000011
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 997-1131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000416
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 5 Region: 669-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000484
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 6 Region: 171-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000549
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 7 Region: 775-890
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000879
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 520-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000016
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 740-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000286
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 10 Region: 972-1008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 134-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 12 Region: 479-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 13 Region: 887-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000617
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 1127-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000866
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 15-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 91-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000213
Family EGF-type module 0.03
Further Details:      
 
Domain Number 17 Region: 941-977
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000482
Family EGF-type module 0.028
Further Details:      
 
Domain Number 18 Region: 55-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000154
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000953
Domain Number - Region: 1170-1207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00022
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 708-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000488
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000953   Gene: ENSCSAVG00000000533   Transcript: ENSCSAVT00000000963
Sequence length 1219
Comment pep:known reftig:CSAV2.0:reftig_235:18463:37506:-1 gene:ENSCSAVG00000000533 transcript:ENSCSAVT00000000963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRTGYGGATCNVDDSSCDASHCLNGGTCHTSIEAGQVVRMCACPFAYTGSTCEVPISSCE
EADCVNGECEIRSGTAVCVCEQGFTGSRCNQVDYCYTNPCKNGANCTNRPLQFVCHCTAN
WFGATCQNFRSPSTPCTPDPCVNSGTCVEKSTTEHQCVCLPGFEGVNCEIDIDDCEGDPC
HNGATCIDQANSALCQCTDGWTGATCDVDVDECMLNPTACLNGGTCVNTEGSYQCTCVNG
WTGDDCSENVDDCASKPCFFQGTCVDYVGTFKCICPPGKTGLLCHMDNACEETPPPCAAW
AQCEINPLTGTAICTCPEGYTGVNCSLDLNECDLGTNPCEYGGTCQNLPGTYECQCAPGF
TGPRCEVNINECESNPCVNDATCLDKIGKFLCLCMPGYTGMTCSEEINECSANPCDYGGE
CIDHINSYTCNCAAGYTGKNCEININDCASTPCQNHIQCVDGVNDYSCVCKAGYDGKNCE
NDIDDCATSPCHYGTCVDGINRYTCNCQLGYGGSLCDSPINECDSTPCQNGGTCHDLVAS
YSCDCPLGTSGTNCEINIQECASSPCQHGQCIDGINKYTCDCDPGYTGLHCEADIDECLS
DPCYNGGTCINNLNSFVCHCPAGYNDPRCYSNINECTSNPCQNGFCHDDINKYVCECNAG
YEGVNCEYNIDECESKPCLNGASCVDHVDSYSCTCRPGYKGTDCETALTPCDPQPCNNGG
SCHPNADYLGYSCTCTEGFQDPCMNGGTCLDDVNSYKCLCKRGFDGGQCQNDVDECASGP
CQNGATCTEYVNSYACTCQPGFRGSTCNENINECITGSCLNGGSCVDGINSYSCNCVAGF
TGNNCERDIDECSSSPCQNGAPCLHGIDTFTCQCLTGYTGPTCAQLVNLCQPNPCNNGGQ
CSQTGTTFMCVCTSGYTGVYCDVPRMSCAAAAASRGVEETQLCQHNGQCINRGSTHYCSC
STGYVGSYCETDFDDCASYPCKNGATCTDYPGSYTCTCVDGFVGTDCATELNECSSDPCL
HNGQCVDLVNSYKCLCQVGTSGDRCQDNENDCTPTSCLNSGSCVDGIGGFTCNCVPGYAG
PSENRDVNECSPNPCNPDGSTNCIQGINTFTCTCKQGFTGGRCEKQLTSCSTMPCLNGAT
CTDATYEPTGYRCTCPTGYRGTNCDEVMSKCHDGLVCYNGGTCHESSSGGEICMCPADYN
GDNCIYYIPGQPAGVGTND
Download sequence
Identical sequences H2Y6K5
ENSCSAVP00000000953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]