SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000001108 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000001108
Domain Number 1 Region: 592-723
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 710-837
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000377
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 120-256
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000413
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 848-973
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000228
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 7-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 243-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000534
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 549-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family EGF-type module 0.021
Further Details:      
 
Domain Number 8 Region: 382-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000018
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 9 Region: 497-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000922
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000001108   Gene: ENSCSAVG00000000614   Transcript: ENSCSAVT00000001119
Sequence length 975
Comment pep:novel reftig:CSAV2.0:reftig_162:15756:42601:1 gene:ENSCSAVG00000000614 transcript:ENSCSAVT00000001119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDECADSSLCPNAACSNSEGGYSCSCLTGFTLANSSCTNIDECVSPNLNNCSSNATCNDT
RGSFTCSCNPGFTGDGENCTDINECTLGTQNCHANATCTNNIGSFTCSCNTGFTGDGVNC
TDINECTSGTHNCHANATCTSKDGSFTCSCNAGFTGDGVNCTDINECTSGTHNCHANATC
NNNIGSFTCSCNPGFTGDGENCTDINECTLGTQNCHANATCTNTIESFTCSCNTGFTGDG
VNCTDINECTSGTHNCHANATCTSKDGSFTCSCNAGFTGDGVNCTDINECTLGTHNCHAN
ATCTNTIESFTCSCNFLFFGDGFTCMCKFLYYYTKFKVNPYNFILTDVNKCSSSPCSPNA
NCTNTAGSFVCSCNTGYTGRSRCTDDVNECANNPCAANADCSNTIGSYTCTCQTGYMFVL
LGVVCLHFFSFFSCTEAYVGDDCSDDRNGCEFSACYTGVNCTDNPAPGTGQTCGSCPAGT
AVFRKLCNCNEGFTKLANATTCSDVDECMTGSFNCSNDSTTCLNSFGSYVCDCKNGYTSY
MCFLKKILIDECAISNLNNCSSNATCNNTIGSYTCSCNTGFTGDGVNCTDINECTSNIHN
CHAIGTCTNNNGSYTCSCNTGFTGDGVNCTDINECHIKHNCHTNATCTNNIGSYTCSCNT
GFTGDGVNCTDINECTLGTHNCHTNATCTNNIGSFTCSCNTGFTGDGVNCTDINECTLGT
HNCHANATCTSTTGSFTCSCNTGFTGDGVNCTDINECTLGTHNCHANATCTNNIGSFTCS
CNTGFTGDGVNCTDINECTLGTHSCHANATCTSTTGSFTCSCNTGFTGDGVNCTDINESQ
LVSFTCSCNTGFTGDGVNCTDINECTLGTHNCHANATCTSTTGSFTCSCNTGFTGDGVNC
TDINECTLGTHNCHANATCTSTTGSFTCSCNTGFTGDGVNCTDINECTFGTHNCHANATC
TNTVGSFTCSCNVMY
Download sequence
Identical sequences H2Y710
ENSCSAVP00000001108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]