SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000001867 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000001867
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily vWA-like 1e-25
Family Integrin A (or I) domain 0.002
Further Details:      
 
Domain Number 2 Region: 107-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000172
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 163-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000184
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 4 Region: 194-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000703
Family EGF-type module 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000001867
Domain Number - Region: 244-295
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00195
Family C-type lectin domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000001867   Gene: ENSCSAVG00000001096   Transcript: ENSCSAVT00000001900
Sequence length 304
Comment pep:known reftig:CSAV2.0:reftig_417:42473:45930:-1 gene:ENSCSAVG00000001096 transcript:ENSCSAVT00000001900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYRGGGTKTGQAIQHVIDNTMKTANGARADAQKIVIVITDGRSQDDVLTPSIALRDSGA
ITFGIGIGAGVLENQIQEIAGDTSRAFIVDTFDQLSGVILNHVKQAVCYDVNECDTNNGG
CSDTCVNTQGSFHCTCPENMILDSDLATCISNTTGQRAAFDECSVDNGGCSDGCVDTLEG
FNCTCAPGFVLKADLLTCEDADECLDAMCSHTCVNTPGSYFCECPKEYQMSEDRITCTLR
ASEADCDAGFMPKGHSCTQQNNEALAYVPAEEACAAAGGRLMKIADSGVRQIMSRNYQGA
NFVG
Download sequence
Identical sequences H2Y969
ENSCSAVP00000001867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]