SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000003151 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000003151
Domain Number 1 Region: 169-227
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000235
Family Kelch motif 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000003151   Gene: ENSCSAVG00000001873   Transcript: ENSCSAVT00000003199
Sequence length 229
Comment pep:novel reftig:CSAV2.0:reftig_234:170466:173747:-1 gene:ENSCSAVG00000001873 transcript:ENSCSAVT00000003199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMLKSHCEKFLIRQVAESNCLGLMQFASLHALDRLYSKAKRYAVKNFSKVSLQEEFLRL
PLPTLSKYLEDHGLVVQREEHVYDAALRWLEYDPSRKPHAAVVLRCVRLFFVSSRFLFEV
VSKQPLFEGDPQVHKIISEACKYHALGSHEMKHGNQPHTKPRAASGISEVLVVVGGISNN
RRLLYTECYHPIKQDWISLSDISTPHSTMHSYSVCSHKNDIYIAGGHSN
Download sequence
Identical sequences H2YCV3
51511.ENSCSAVP00000003151 ENSCSAVP00000003151 ENSCSAVP00000003151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]