SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000003574 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000003574
Domain Number 1 Region: 566-745
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-46
Family DBL homology domain (DH-domain) 0.00000184
Further Details:      
 
Domain Number 2 Region: 754-876
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-17
Family Pleckstrin-homology domain (PH domain) 0.00037
Further Details:      
 
Domain Number 3 Region: 264-375
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000216
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 4 Region: 5-161
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000144
Family CRAL/TRIO domain 0.01
Further Details:      
 
Domain Number 5 Region: 337-482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000273
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000003574   Gene: ENSCSAVG00000002125   Transcript: ENSCSAVT00000003629
Sequence length 877
Comment pep:novel reftig:CSAV2.0:reftig_167:84600:99212:1 gene:ENSCSAVG00000002125 transcript:ENSCSAVT00000003629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATSLRHHLQQCYVYIHGGKDMSGSPVICFPHFPGLHDVSNEGFKDTLYYLTHTTRYSLAD
LGFVVILDRRKDKWSSLKATLVRLAENFPGNIRIVLVLKPLGFLQGAITNFGFRWQKDEF
AMKVPVVLLSSLDDLSRYVLPTELTNHFGGTFQYDHITWINNRMLVETFSAKATSAILAL
EEYGSQLAESELPNDSKSAVVLINTQQIRTNTQKDGIEMLRKEAALLRNEISISNNNDVN
AIEAGLMECYETLISETDVTFDNFWLKYKEKMKQCLQLRLFEEDYRDVCSKLETVRQQIE
SKYLNVGITFPWLEAFISGLSDLEQSTNECLEVCGKVRQHGCDLVAAGHYAVDCIQPKTD
ELQNQTCEIKEQITELQCSFKSYQHFINQLNEVRQWCEDGMAFLAGQVLETSLTVDGANS
ALNELEIKFEKKEQNVQILVENSVVQSQCGRLWSAEAEELSCHVKSRLTEVTLLYEKRRS
SLKKAATKHGERPVQLVEPSKKVVSTTKGSKRDPPRDGKEQVVSQANIFLPYSIYKRNYY
IVFFNFYNKNKILKNSFYLQISNISRHVMKELVSTEKTYISELKSIVEGYGRPMDDPTHP
RVPATLLGKSKELLGNMDEIYDFHSNVFLGLLEECVDNPSSVGRCFLSKKENFEIYSKYC
QNSIKSEQLRRLVGEQHPFFMQCQQKLGHRLSLSAFLLKPVQRVTKYQLLLQQMLKYSNS
HLKELQTALDAMLEILKSVNDGMHQVMITGYQDDLTLLGKLHLQSQFTMQVDHKKSRVKS
LKRPRFSKAIQRHLFLYDDEILICKPQTMESLDDNDNHFKSNNQSVASMENAGMLDTIKS
DPRKFEVWSEGREHVYTLQAPTIITKQEWIKGLKSIL
Download sequence
Identical sequences H2YE26
ENSCSAVP00000003574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]