SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000004050 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000004050
Domain Number 1 Region: 409-522
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000377
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 553-713
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 3 Region: 183-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 219-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000478
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 5 Region: 801-838
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000942
Family Somatomedin B domain 0.0028
Further Details:      
 
Domain Number 6 Region: 301-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 348-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000191
Family EGF-type module 0.022
Further Details:      
 
Domain Number 8 Region: 635-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000021
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000004050
Domain Number - Region: 29-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000113
Family EGF-like domain of nidogen-1 0.065
Further Details:      
 
Domain Number - Region: 282-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000004050   Gene: ENSCSAVG00000002390   Transcript: ENSCSAVT00000004110
Sequence length 838
Comment pep:novel reftig:CSAV2.0:reftig_30:824963:835765:1 gene:ENSCSAVG00000002390 transcript:ENSCSAVT00000004110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLALTVLVNLIVYHEGINIFISVLPYAHPCRPNPCGSYATCTARGSRYTCKCNSGYVGNG
RICVRPPTCGTGYRWSRFFNRDRPSGNCDCENHSLLRQSYPNEVCRNPRDVDVVDASTNL
DYRVYGQVVTIKTPQEKAFTCYNRQQKRGQKCRNYKVRFCCGKYLGGLLICFVLVIYNYF
YSDVNECDRPNICGSNKRCVNTPGSYRCICNQGYSLVDGQCVDIDECNRRPRVCDGKERC
VNTQGSYRCVCKPGYEKIRGRCVAIMSYGVRFKTKVVVRHVCLCADGHSNFSCQCNHGFT
GDGQSYVYINECSSSPCDGNARCTNTPGSFRCQCNRGFTGNGLTCTALNPCSPNPCGSNA
VCRNVHYRAVCSCLPGFNGNPLVGCSGKTNNRFLIVISLTFKFNLPTFPDINECNAPVKP
CHSNAQCTNTVGSFTCACNTGHTGDGQACADIDECLNPSACHAQAACTNSPGSFSCQCNN
GFTGDGQSSSNPCLPNPCGSNAVCHNVHYRAVCSCLPGFGGDPLVECPGNTINQNDFLIV
ICLTFKFNLPTFPDINECNAPVKPCHSNAQCTNTVGSFTCACNTGYAGDGQACADINECS
NPSACHAQATCTNSPGSFCQCNNGFTGDGQSCVPLNPCLPNPCGSNAVCRNVHYRAVCSC
LPGFGGDPFIGCSALNPCSPSPCGRNAVCRNVHNRAVCTCPLGFVGNPFVICNSKLSELS
GNETTCLVGALNKNTRAINTHTHTHIKATGSASISNNICRKHPIKHSLFIRIVACISCPI
CEKNFSVNGINRHLDICTGLASCRGFCGSHVPKTHPCGCDSSCYRYNNCCDDYRQLCT
Download sequence
Identical sequences H2YFF2
51511.ENSCSAVP00000004050 ENSCSAVP00000004050 ENSCSAVP00000004050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]