SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000005522 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000005522
Domain Number 1 Region: 347-546
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-54
Family Nuclear receptor ligand-binding domain 0.0000125
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000897
Family Nuclear receptor 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000005522   Gene: ENSCSAVG00000003303   Transcript: ENSCSAVT00000005596
Sequence length 550
Comment pep:novel reftig:CSAV2.0:reftig_134:62:11319:1 gene:ENSCSAVG00000003303 transcript:ENSCSAVT00000005596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGFFRRTIRLKLEYETCMEACTVSIKSRNKCQFCRFKKCIGLGMSRDAIRFGRMPRHEKQ
QIIREIDESFAQATGSDKCQIKMQNLITEVSESFLRHISLTAERVNKCWESRKTLGDKAK
TLHTFQDIPACFPNLSEYFSQFKTLVTQEDGSFSAPWITLTEHLVKMYPDSGNTDTNSHK
TAPATQKVFPSTPSHSQSTPSSVNKSNSSSNTAATPSISKPPAALSELPLEEELAQNHTD
VPPPPPPKPPVVSGAAPFLNPDRLDSIKTFHGMYKNICSISDKVHKAQLESDPDFLEGMD
PKKLVSAVDEALTPDHKARLLFASQILKKRTQKGSGPSSKPLLFGRNALGSKIVQILYCD
FQARVVKGICELTEFAKSLPNFLRISLHDQVILLKYGSYETMFVLFSRLIIEDGMLLPKS
NIYVTFNFVYQLGVVGEIMRSKFEFAKRMLSLGLTDVEMALFVGVILLCPDRPGIDNRKV
VEDIQEEILLALEYQLSLTHPNKPRLFAHLLLKLAELRELMSKHVSMVQKLSEMKGIGPP
LLNEILQDLT
Download sequence
Identical sequences H2YJM3
51511.ENSCSAVP00000005522 ENSCSAVP00000005522 ENSCSAVP00000005522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]