SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000005523 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000005523
Domain Number 1 Region: 141-346
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.22e-55
Family Nuclear receptor ligand-binding domain 0.00000754
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000459
Family Nuclear receptor 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000005523   Gene: ENSCSAVG00000003303   Transcript: ENSCSAVT00000005597
Sequence length 348
Comment pep:novel reftig:CSAV2.0:reftig_134:62:11319:1 gene:ENSCSAVG00000003303 transcript:ENSCSAVT00000005597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGFFRRTIRLKLEYETCMEACTVSIKSRNKCQFCRFKKCIGLGMSRDAIRFGRMPRHEKQ
QIIREIDESFAQATGSDKCQIKMQNLITEVSESFLRHISLTAERVNKCWESRKTLAAPWI
TLTEHLVKMYPDSGNTDTNSHKTAPATQKIVQILYCDFQARVVKGICELTEFAKSLPNFL
RISLHDQVILLKYGSYETMFVLFSRLIIEDGMLLPKSNIYVTFNFVYQVSKMVGEIMRSK
FEFAKRMLSLGLTDVEMALFVGVILLCPDRPGIDNRKVVEDIQEEILLALEYQLSLTHPN
KPRLFAHLLLKLAELRELMSKHVSMVQKLSEMKGIGPPLLNEILQDLT
Download sequence
Identical sequences H2YJM4
ENSCSAVP00000005523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]