SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000007171 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000007171
Domain Number 1 Region: 31-318
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.37e-17
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000007171   Gene: ENSCSAVG00000004287   Transcript: ENSCSAVT00000007264
Sequence length 370
Comment pep:novel reftig:CSAV2.0:reftig_99:222790:225791:1 gene:ENSCSAVG00000004287 transcript:ENSCSAVT00000007264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNILPDVVPSVSQTAKFEVVMPKRLLTSTKPGLKPACIHMAGTGDHGFHRRRELLGKPLL
EAGITSVLLENPFYGSRKPKDQWRSGLLHVNDLFVMGSCLILEAQVLLHWLKRNGFGPLG
LTGISMGGHMASLAATNWPEPVALIPCMSWTSASVVWTEGVLSRAIPWRVLEQEYSKKPI
FEKEISKFLKEVDSYTLGKEFAGHTGSNGPQGKLPDAALDKENNSKDEKRRQRETVRFMR
GVMDQVTHLGNFSVPVDPTMATFVIAKGDAYFPKSNLTPVKDIWPGCQIREINSGHVAGC
LIHTSAFNRAIIDTFSRLITKYHTGESERETSISDGSNELVIAQPSALRKFSARQSFSLK
SFVRAFLIKA
Download sequence
Identical sequences H2YPB3
ENSCSAVP00000007171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]