SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008452 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008452
Domain Number 1 Region: 903-1042
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 1287-1412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 2753-2917
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000424
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 4 Region: 1767-1899
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000141
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 5 Region: 540-672
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 1515-1653
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 250-371
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 8 Region: 2558-2695
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000303
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 659-800
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000487
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 10 Region: 2991-3106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000549
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 786-917
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000785
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 12 Region: 2409-2536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000863
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 13 Region: 1146-1289
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000111
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 14 Region: 1-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000149
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 15 Region: 2197-2335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 16 Region: 1643-1772
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 17 Region: 1895-2045
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000549
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 18 Region: 1989-2137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000392
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 19 Region: 2947-2996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.011
Further Details:      
 
Domain Number 20 Region: 109-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000108
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 21 Region: 473-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family EGF-type module 0.016
Further Details:      
 
Domain Number 22 Region: 2328-2376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000305
Family EGF-type module 0.02
Further Details:      
 
Domain Number 23 Region: 1101-1137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 24 Region: 2680-2731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000261
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 2362-2409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000036
Family EGF-type module 0.012
Further Details:      
 
Domain Number 26 Region: 376-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.014
Further Details:      
 
Domain Number 27 Region: 1436-1527
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000298
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 28 Region: 2908-2954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000439
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000008452
Domain Number - Region: 414-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 2133-2159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000458
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008452   Gene: ENSCSAVG00000005019   Transcript: ENSCSAVT00000008561
Sequence length 3111
Comment pep:novel reftig:CSAV2.0:reftig_44:495276:533261:1 gene:ENSCSAVG00000005019 transcript:ENSCSAVT00000008561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNNTLGSYRCECKEGFLGSSGSCSDINECSRDVFICDQRCVNTFGSYECACFTGYSIANN
STCTGTNARYIDECTNGTHACTGNLVCVNTDGAYYCDCAAGFTASGTTCQDINECETNTH
NCSDLAVCKNTVGSYTCTCREGMNGDGYNCEYVNECLAPGICGLYSVCVNTEGSFYCECD
EGFVTDGEACIGDSTSAPLLCDKTCHKNAYCKIIQGSPTCLCKAGFSGYGDLNCAAEHRH
QENLLFLPFPDINECMYRTHTCTAVQNCVNYPGGYSCQCITGYEDVNGYCVDINECENDP
CGSGQCKNTAGSYRCYCATGFYKYDGVTCSDIDECRQVRGICGTNKTCTNSVGSYSCSCK
TGFVVVASDQCIGMGNIDECIEQTDNCTGNKECVNQPGSFNCICISGYEPDSYGNCKDIN
ECIKKIYDCPVNSKCINDDGGYDCTCFNGFELDSQDRYCLNKISYCFFLIILDIDECSTK
THNCHNSATCTNTPASFDCNCIEGFTANMIWVCLICYKWDFFILFFHMILGLILFIPDIN
ECENDVCGSNSECINRVGTYECKCLDGFSISGAECIDIDECKHQPPVCPENSVCSNTVGS
FGCECKTGFTGDGVSYCIDIDECQENPDQCGNVAECRNTAGSYTCVCKDGYKINSVGICE
DIDECKTGEQNCQINSECLNTVPGYECPCKIGYTGEGKNLGCTDNNECLLGNTTCARTAE
CVNLPGSYRCKCADGFTGDPSINCTDIDECGLGIFQCTTEQNCQNTPSSYKCVCKTGYIM
NNRTQGCEDIDECSSDQNDCSGKTECVNTIGSFTCQCLDGYAKQNGGSFCEDIDECSTGA
ARCVLNAECSNEPGTYQCTCVEGYTGDGKLLCTNINECSEGTHNCASNSRCTDTIGSFKC
SPCLPGFKGSPFTVCEDIDECALGLTGCHTNADCINTIGSYQCKCNAGYTGDGFTCEDID
ECSNELSKCATHATCQNSPGTYTCTCNEGFTGNGSVLCTDVNECQDPSWNNCVQYSDCLN
LAGSYYCQCIAGYTGNPTESCFKTRRGATIVNVELATKPTLTSLASVIETRLSKQSQATF
MPLAHSSKSNVRCDCILIDTLLPDVDECAAGTSQCGDNSKCQNTIGSYTCICADGYISII
NVKMFPDVNECLDNKDICPHPSACTNNVGSYECTCIEGYQMDGGKYFLFFHNSQTLYFNM
DQTLSDINECLSNPKCMQRSKCVNNNGSYECICRSGYEMSPSGGCTDINECVEPTKACLP
NSECLNTVGSYSCTCKEGFQETGDQGFCENINECQPSASPCAEKAVCEDTVGNYSCKCEP
GYQGDGYNSCCANTTNNECVQKATCINTVGSYNCECGEGYSGAGDILCEDINECLLPDTC
STPPATKCVNLPGTYRCDCADGFALDNKGVCVGEIWFQVMFSEECPLISIHRIYSAKCTN
LIGSYECTCKPGFTGDGKTQCDGHKKKKTKPIYPLLDINECESTNTTCSNNSRCENKIGT
FICICEVGYSQDPCRDIDECATGEANCDADAVCTNTDGSFICNCNSGYQDNGFGGCKDVD
ECAITDICIENAICSNTVGSYSCNCDSGFEGNPSLSCDDIDECLLDQANCDKNAECTNLI
GDFICSCKTGYEENPTTRVCEDIQECSLEPKKCAPNSQCENNVGGFTCTCVQGYYTTIPL
LFQPLSLTDYDECIIDDIKCHDNSACVNTLGSYECRCDQGFVSASNATCKDLDECAVLPT
KCLSDSVCINTVGSYECRCKDGYKGDGATGCVDVDECAAQADLCGQSAQCENTLGSFKCV
CNAGTTGSGDGSGICSDIDECKLELDNCATNSLCENTAGSYKCVCKDGYTGDPTVECTDI
DECEIGRSNCLSDAVCINSIGSFRCECSIGFQGDGVNECNNFDECALGTDNCDINSECSN
TPGSYTCVCSAGFQMLNGNCTDIDECSTQQPCAENGECTNSIGSYTCLCKEGYTGVGDIS
CISNYECSCKEGFNGDGNVYCSSRCSGFSLLSDSCKSGTHNCLSVAQCVNVPGSFICKCG
NGFTGLVYTIIKHYIDECANGSDNCTENAECTNTAGSFVCSCVVGYTGDAAVVSCSDIDE
CFNERPICARNALCFNEIGNYTCTCNTGYTGDGNVCVNNVGSFNCLCVDGYESDGSSCKG
SCFIKMSSSLKKSWDLRLLEKILTFFYVYCITFVYFFFQCADIDECVKQMDDCDVSANEQ
CLNVDGGWECGCRPGFNRNSEDICEDIDECAEGTDQCGMDCANTIGSFQCSCRDGYKMSD
SGTCTDIDECSTGVDDCKENSVCTNTVGGYTCKCDHGYQGDGKVSCSDIDECKDGLSDCD
VYANCSNTPGSFECNCVNGFHGDGKQCLDINECANTTNPPCPLNGQCKNTPGLYACDCLD
GYQKDGNLCSNINECIRNPCHFEALCVDTDGSYTCTCKIGFTGDGKTCTDINECIGGTSE
CVENADCINTVGSHKCTCKDGYSGDGKLKCLKLILMFSIKYYVNKCSTGAAQCQTNSACV
NTAPGYTCVCDAGYTGVMEKSSAQVNVVLFTRKKIASNIDECTEGTYDCQVNSVCENNIG
SYTCVCNSGFEMLNTICQDIDECLLGTHNCSGNATCTNNIGSYVCDCNRGYTGDGYLCED
INECIVSPNACPSPSVCENTAGDFECKCTTGYERKSGEATCTDVDECASPNTFKCADNAD
CVNTKGTYVCSCSTGFVGVGTDSCTDINECKEGTDDCGINSLCINDVGGWTCECQSGYSG
DPDIDECSNGDADCDTNSRCQNTVGNFICACNPGYTGDGKQQCQGKLIKCKQVSHINNVF
SDVNECDLKLDNCGSNSVCENALGSFTCPCSDGYVKTDGAVCKDIDECSLGTDNCHPDVG
TCQNTLGSFTCSCITGYIGDGVTCVAKDLCGTGAHNCSEGTICKNTDDGFICTCDPGFEM
VADTCKDIDECASPFLNDCAENGNCTNTNGSYSCACKIGYSGDGKTCDDINECNDDKLNT
CDTNATCTNNEGSYQCACITGFSGNGVICQDIDECAISTNCDQNADCSNNVGSYTCSCKT
GYSGDGITCQDINECEASTPPCHANAECVNTDSSFTCTCNFGYVGDGISSC
Download sequence
Identical sequences H2YSZ2
ENSCSAVP00000008452 ENSCSAVP00000008452 51511.ENSCSAVP00000008452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]