SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008458 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008458
Domain Number 1 Region: 203-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000275
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 46-169
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000029
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 707-839
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000471
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 4 Region: 596-731
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 840-956
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000108
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 919-1034
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 407-449,516-597
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 162-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000591
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 9 Region: 3-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000534
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 361-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000468
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008458   Gene: ENSCSAVG00000005019   Transcript: ENSCSAVT00000008567
Sequence length 1036
Comment pep:novel reftig:CSAV2.0:reftig_44:505333:530101:1 gene:ENSCSAVG00000005019 transcript:ENSCSAVT00000008567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDECQENPDQCGNVAECRNTAGSYTCVCKDGYKINSVGICEDIDECSSDQNDCSGKTECV
NTIGSFTCQCLDGYAKQNGGSFCEDIDECSTGAARCVLNAECSNEPGTYQCTCVEGYTGD
GKLLCTNIDECALGLTGCHTNADCINTIGSYQCKCNAGYTGDGFTCEDVDECAAGTSQCG
DNSKCQNTIGSYTCICADGYISSGLYSCDDVNECLDNKDICPHPSACTNNVGSYECTCIE
GYQMDGGKCVDINECLSNPKCMQRSKCVNNNGSYECICRSGYEMSPSGGCTDINECSQGI
DNCGGNATCINTVGKYNCTCNVGYTGDPFKHCKCEPGYQGDGYNSCVGNKKKKTKPIYPL
LDINECESTNTTCSNNSRCENKIGTFICICEILTNVQPEKQTVMQMQCVPTPMVVSFATA
TNAICSNTVGSYSCNCDSGFEGNPSLSCDGKNSIYCTRIFYIKILFLQQEFGKCVLRTRK
QNENLNPFLISYNFKPYKSIGNIEVFHFKFHSDIDECLLDQANCDKNAECTNLIGDFICS
CKTGYEENPTTRVCEDIDECSNTSLVCRPNSECLNSPGSYICKCLEGFEDINGDCIDLDE
CAVLPTKCLSDSVCINTVGSYECRCKDGYKGDGATGCVDIDECSTQQPCAENGECTNSIG
SYTCLCKEGYTGVGDISCINIDECFNERPICARNALCFNEIGNYTCTCNTGYTGDGNVVY
NNECETYKCHANSECVNNVGSFNCLCVDGYESDGSSCKDIDECAEGTDQCGMDCANTIGS
FQCSCRDGYKMSDSGTCTDIDECSTGVDDCKENSVCTNTVGGYTCKCDHGYQGDGKVDCD
VYANCSNTPGSFECNCVNGFHGDGKQYINECIGGTSECVENADCINTVGSHKCTCKDGYS
GDGKVACTNIDECLLGTHNCSGNATCTNNIGSYVCDCNRGYTGDGYLCEDINECIVSPNA
CPSPSVCENTAGDFECKCTTGYERKSGEATCTDIDECSNGDADCDTNSRCQNTVGNFICA
CNPGYTGDGKQQCQGK
Download sequence
Identical sequences H2YSZ8
ENSCSAVP00000008458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]