SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008459 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008459
Domain Number 1 Region: 122-252
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.46e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000345
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 365-495
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000502
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 457-575
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000926
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 5 Region: 247-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 6 Region: 587-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000324
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 629-664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000458
Family EGF-type module 0.036
Further Details:      
 
Domain Number 8 Region: 668-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000041
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000008459
Domain Number - Region: 300-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000111
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008459   Gene: ENSCSAVG00000005019   Transcript: ENSCSAVT00000008568
Sequence length 736
Comment pep:novel reftig:CSAV2.0:reftig_44:512631:531270:1 gene:ENSCSAVG00000005019 transcript:ENSCSAVT00000008568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECSQGIDNCGGNATCINTVGKYNCTCNVGYTGDPFKQCIDINECQPSASPCAEKAVCEDT
VGNYSCKCEPGYQGDGYNSCVDFDECANTTNNECVQKATCINTVGSYNCECGEGYSGAGD
ILCEDINECLLPDTCSTPPATKCVNLPGTYRCDCADGFALDNKGVCVDVDECAITDICIE
NAICSNTVGSYSCNCDSGFEGNPSLSCDDIDECLLDQANCDKNAECTNLIGDFICSCKTG
YEENPTTRVCEDYDECIIDDIKCHDNSACVNTLGSYECRCDQGFVSASNATCKGYICFDV
NSLNALCFNEIGNYTCTCNTGYTGDGNVSCFIKMSSSLKKSWDLRLLEKILTFFYVYCIT
FVYFFFQCADIDECVKQMDDCDVSANEQCLNVDGGWECGCRPGFNRNSEDICEDIDECAE
GTDQCGMDCANTIGSFQCSCRDGYKMSDSGTCTDIDECKDGLSDCDVYANCSNTPGSFEC
NCVNGFHGDGKQCLDINECANTTNPPCPLNGQCKNTPGLYACDCLDGYQKDGNLCSNINE
CIRNPCHFEALCVDTDGSYTCTCKIGFTGDGKTCTGLSVIFLYSNTNINECIGGTSECVE
NADCINTVGSHKCTCKDGYSGDGKVACTNVNKCSTGAAQCQTNSACVNTAPGYTCVCDAG
YTGVMEKSTTVSTDIDECSNGDADCDTNSRCQNTVGNFICACNPGYTGDGKQQCQAKDLC
GTGAHNCSEGTICKNT
Download sequence
Identical sequences H2YSZ9
ENSCSAVP00000008459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]