SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008684 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008684
Domain Number 1 Region: 93-308
Classification Level Classification E-value
Superfamily GFP-like 9.21e-48
Family Domain G2 of nidogen-1 0.00034
Further Details:      
 
Domain Number 2 Region: 36-87
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000209
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 416-542
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 540-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000259
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 5 Region: 336-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000222
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 369-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000648
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000008684
Domain Number - Region: 1-34
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000785
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number - Region: 581-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000876
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 313-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0312
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008684   Gene: ENSCSAVG00000005157   Transcript: ENSCSAVT00000008794
Sequence length 745
Comment pep:novel reftig:CSAV2.0:reftig_67:371777:381428:1 gene:ENSCSAVG00000005157 transcript:ENSCSAVT00000008794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNRIRTCSEPFPVNGGRPCSGSSSQMDHCNVDPCSVNGEWGDWGSWSECSRSCGGGQMNR
YRSCSNPTPRFGGRFCPGSDSDLQPCGLQSCPGGPREAQGIAFGTINDIPFGGSEISANG
TNIGDDKTRIIAELDNIPPSVGPALKSQIAILSPIGWTMAREIQEAYNGYTLTGGEFNRD
VMVEFASGDVVKMTHHVHGVNSQGKLQMDVSLEGTVPEVHLGTDIELKDYTEDYLQTDAG
ELYAYSDRLLVLDGYILPYTWNHSITYNSSRGLMPFLVETLSVTDIVVDYDEVLRTLRFQ
MDVQIGPGNPSDRCPTGFLLESSGRYCRDNNECSTNRPCSHTCTNVPGSFVCGCPDGFSM
GPDGRNCEDVDECGTGQYICRPTTECLNTLGSYRCVIRCGFGLKRSENGRTCEDIDECQD
SEDRVCSQVCHNTIGSYRCECRHGYRKRSGGRCIDINECRPGSRACRSDQRCENSDGGYR
CIDDCPKGMEKNLFSVCVDIDECATGRHECGVGMQCQNTEGGYTCDCRPGFKASGIQPPC
VDIDECRELSGICQYSCNNSLGSYSCLCPRGYRVADNGRNCEDIDECAEGLMHCLPNQMC
FNKRGSVTCINTPCPPSYVRVSSNGYCLKQCVGRNCHTQPRYAIEYKTVALPFGIGANQD
LVRLAVYTSDDQLHRNTRFVAKNTFQGPFDIRTSNHKGVVYTTRALNTARTYHLEAQATS
FTYDNTRIEYQTKFIIYISVAGHRF
Download sequence
Identical sequences H2YTM4
ENSCSAVP00000008684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]