SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009501 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009501
Domain Number 1 Region: 8-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-28
Family Nuclear receptor 0.0000926
Further Details:      
 
Domain Number 2 Region: 78-92,437-444,472-565
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.15e-18
Family Nuclear receptor ligand-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009501   Gene: ENSCSAVG00000005587   Transcript: ENSCSAVT00000009618
Sequence length 567
Comment pep:novel reftig:CSAV2.0:reftig_72:1344789:1355851:1 gene:ENSCSAVG00000005587 transcript:ENSCSAVT00000009618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTTTLLDMPCKVCGDKSSGVHYGVYSCEGCKGFFRRTIHQKIKYRSCILDGACTVTKIN
RNRCQTCRFMKCLYVGMSKDAVKYGRIPKKQKARLIAERLAEKRRERLMDQCKENSEMMF
DDENDHVTPKNGGFTESPLENMTPSESLLYQALHGSGGLKPALGDPPIEPTPVLRNPPEL
IPRCDFLSKGKSNINFSRSTSKDFGSDHREFQQHPEQRYGEKDFSSSGGHPDQRINSSKV
RSASDSSSSRSNLVSPPPLLLLGAPLSRGLESAKLDEGFQRYGNRSADTVRKYPIFNFDK
INEKYGKMTPQSHFFTKKQFSDGKRQNQGYLTSEPPKNNYPLAPSCYSEAVLPRNFPMLA
NTYPIVYPALYTISQSSVTNSGIVTSHPIFVTSHNDIIAQERSPLASPVKHFGSAPKVRI
NNNSTSSSVAVDYSSRTRSSSSPDSGCPETNDCDMETQKTIGNTGNGSQISIPELISVVV
RAHRETSSVSRHALFLTKVKTNCTDRRYCDVTNNPDWAGFNQCFEPGVREVVEFAKSIPG
FDKLQQDDKVILLKTASFEILLVRMTS
Download sequence
Identical sequences H2YVZ0
ENSCSAVP00000009501 ENSCSAVP00000009501 51511.ENSCSAVP00000009501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]