SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000012497 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000012497
Domain Number 1 Region: 318-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 447-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 287-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000347
Family EGF-type module 0.008
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000012497
Domain Number - Region: 482-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000816
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000012497   Gene: ENSCSAVG00000007340   Transcript: ENSCSAVT00000012641
Sequence length 721
Comment pep:known reftig:CSAV2.0:reftig_49:436455:447674:-1 gene:ENSCSAVG00000007340 transcript:ENSCSAVT00000012641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLMKIRFALLVLSHYFVSVTSEGSFQLRLTQLVNDGGVTESGLCCSGPSFPNCIEQCRT
SIRVCLKHFQATVDPSGPCTFGSYKSPVIGGNSFAPENTSYIRRHPTVFDFTFRWPGSFS
MIVDVLHEVNTETPILISRLIVSNSHVTTQPRSDPTWITPAPFTKHGVELHYSYRIVCKE
YLYGGDCAKHCHPRDDIFGHFSCDEQGNKVCHPGWTNDDNGAYCTSPVCSKGCDTERGSC
RRPNECVCKVGWKGKLCNECATMPGCVHGTCDQRFQCNCNPGWGGSYCNQDLNYCTNHHP
CFNGGICSNTGHGSFTCTCVPGYIGRRCQFKISACSPNPCHNDGECIEKADGYECKCKNN
FYGSLCERTHVTCYDSPCNNGGLCVPQKDKYMCRCTQQWKGYNCEERVDPCSPNLCLNGG
ICSVRNNIPKCECRDGFAGRFCNVNTQCVNNLCLNGGSCLTRSQGFQCTCPPGYKGRLCG
KLDNCFSSSCLHDESCPMLENRRSCICKFLFTATSCEAIERNCDIRICNRGDCENGSNGC
GCLQNFTCLSEPPVPPTNIKSITNLPSSIHSKLVVVSKTSASPQLSTTHWIVITFCVGSL
LLLLVLILACVMYARNSRKAVKSSSETSESPMESVQTWDAGQSAADVSKLSVVKAEINID
AEATKLLDPEPIQTRVALPCAKCPCSHTVVTVEMAKVENLQFDKGPCPTYEEACETSPCL
T
Download sequence
Identical sequences H2Z4I5
ENSCSAVP00000012497 ENSCSAVP00000012497 51511.ENSCSAVP00000012497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]