SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000013166 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000013166
Domain Number 1 Region: 22-288
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.33e-38
Family Proline iminopeptidase-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000013166   Gene: ENSCSAVG00000007724   Transcript: ENSCSAVT00000013315
Sequence length 294
Comment pep:novel reftig:CSAV2.0:reftig_117:705931:713726:1 gene:ENSCSAVG00000007724 transcript:ENSCSAVT00000013315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEDTEKVAKTFSGRPFSEVNHFVNEDGLHIFTNIWKPEGDCKYLICLLHGFGGHCVRFN
ELASYLTKIGGLVFSHDHIGHGESEGYRTTVDDFNKLIRDTYQHVDIMKKQYSDLPVFLL
GQSMGGALAVLAAHERPDIFKGVILIGPMLLIDPGIQSSFKVSLVKIAAYLIPHFIVTSL
PESRGSRDEKEVVISQNDPLKSCDVKSQMALQLLRMGEKLEIVMPEFACPFITLHGGDDN
TCSVEGSKLINQVAKCKDKTIKIYDECRHDLVHELQADRIIFFNDIQAWVEERI
Download sequence
Identical sequences H2Z6F4
ENSCSAVP00000013166 51511.ENSCSAVP00000013166 ENSCSAVP00000013166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]