SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000013848 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000013848
Domain Number 1 Region: 117-303
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000228
Family Nuclear receptor ligand-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000013848   Gene: ENSCSAVG00000008121   Transcript: ENSCSAVT00000014008
Sequence length 311
Comment pep:novel reftig:CSAV2.0:reftig_9:92080:94711:1 gene:ENSCSAVG00000008121 transcript:ENSCSAVT00000014008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTNQCHDLITRSVQDYGDVLAPRMYFVSPTPLMQYPCQYGSFPNIDEGFVKYLEEAQF
SLGCFEPPAAPKLKIKQRKLVTARQKPYRKTSRSPEANEMEPTGMKSPILLRLLQSPDSE
SQTCQRKSDMNSNSTRLSSRIGHLSSENTFGFVEEILQKTEHFFESVPMLGDPSPQQRHG
FFLDYWAEVFIIFCAEKGIEIDAIEKSVRADLDSHCSKRDIHKLHDFVKRCQSMNLSSLE
YEYLRGAVLGIQDGFINTVVSPKSRSVRSSQISLNLLALRSVSSQRIADLFLRPVFGCSD
IEKIQSGSSFK
Download sequence
Identical sequences H2Z8D6
51511.ENSCSAVP00000013848 ENSCSAVP00000013848 ENSCSAVP00000013848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]