SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000014081 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000014081
Domain Number 1 Region: 143-276
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000018
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 1-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family EGF-type module 0.02
Further Details:      
 
Domain Number 3 Region: 373-504
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000235
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 4 Region: 306-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 487-611
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 610-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 38-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.018
Further Details:      
 
Domain Number 8 Region: 271-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000822
Family EGF-type module 0.057
Further Details:      
 
Domain Number 9 Region: 76-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000611
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 344-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000661
Family EGF-type module 0.02
Further Details:      
 
Domain Number 11 Region: 120-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000249
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000014081   Gene: ENSCSAVG00000008259   Transcript: ENSCSAVT00000014243
Sequence length 744
Comment pep:known reftig:CSAV2.0:reftig_1:1423987:1431092:1 gene:ENSCSAVG00000008259 transcript:ENSCSAVT00000014243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNTPINKCDNNQCKSGSTCVALTSGYRCECRAGYSGTYCNTRINNCDNNQCTSGSTCVAL
TSGYRCECNTGYNGIYCNTPINKCDNNQCKSGSTCVALTSGYRCECNTGYSGIYCNTRIN
NCDNNQCKSDSTCVALTSGYRCECNAGYIGIYCSNRINNCDNNQCKSGSTCVALTSGYRC
ECNTGYSGTYCNTRINNCDINQCTSGSTCVSLTSGYRCECNTGYSGTYCNTRINNCDNNQ
CKSGRTCVSLTSGYRCDCEVGYSGRNCEIKVKTNNCENHKCSLGSTCVALSTGYRCQCNA
GYSGTYCNTRINNCDNNQCTSGSTCVALTSGYRCECNTGYSGTYCNTRINNCDNNQCKSG
STCVALTSGYRCECNTGYSGTYCNTRINNCDNNQCKSGSTCVSLTSGYRCECTAGYSGTY
CNTQINNCDNNQCKSGSTCVALTSGYRCRCNAGYSGLYCNTRINNCDNNQCASGSTCVNL
SVGYRCECNAGYSGTYCTTPINPCDNNRCDSGSTCVALTSGYRCQCNTGYSGLYCNTRIN
NCDNNQCASGSTCVTLSVGYRCECNAGYSGTYCTTLINPCDNNRCDSGSTCVALTSGYRC
QCNTGYSGTYCNTRINNCDNNQCASGSTCVNLSVGYRCVCVSGFYGTTCENAGQACSPNP
CVNGCNCVASCMHEGGYYCLDPTMQFTGRNCNNPVPRLECRYDRIVLTLESGFLQDFDKM
EGDSYLYASQSFDDNQRLTECRHV
Download sequence
Identical sequences H2Z916
ENSCSAVP00000014081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]