SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000015954 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000015954
Domain Number 1 Region: 405-535
Classification Level Classification E-value
Superfamily Bromodomain 7.98e-31
Family Bromodomain 0.00054
Further Details:      
 
Domain Number 2 Region: 563-677
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-30
Family Bromodomain 0.001
Further Details:      
 
Domain Number 3 Region: 299-392
Classification Level Classification E-value
Superfamily Bromodomain 3.92e-26
Family Bromodomain 0.001
Further Details:      
 
Domain Number 4 Region: 1-100
Classification Level Classification E-value
Superfamily Bromodomain 5.36e-23
Family Bromodomain 0.0017
Further Details:      
 
Domain Number 5 Region: 108-202
Classification Level Classification E-value
Superfamily Bromodomain 5.23e-18
Family Bromodomain 0.0022
Further Details:      
 
Domain Number 6 Region: 1242-1297
Classification Level Classification E-value
Superfamily HMG-box 1.57e-16
Family HMG-box 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000015954
Domain Number - Region: 995-1117
Classification Level Classification E-value
Superfamily BAH domain 0.0562
Family BAH domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000015954   Gene: ENSCSAVG00000009396   Transcript: ENSCSAVT00000016134
Sequence length 1525
Comment pep:novel reftig:CSAV2.0:reftig_2:2625740:2653148:1 gene:ENSCSAVG00000009396 transcript:ENSCSAVT00000016134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYDVIKDHEDSEGHLVADTFMKLPSKRYHPDYHEKIVDPIDLGKIGQRIRMDEYRDIEIL
TTDIQLMISNAKKYYDAESEEYSDACKLWDLYLTTKARLADNVKPEESKSRPGRKDLDIS
QEELKALYEAIVTETDEDGRVIAEMFMQLPDKTNLEYYQLIKEPIDFLMIGDRMEENYYK
SVIEFEKDVTLLVKNAKAFNDPISQQEKPEKVDLHEASVLDFHEHDYQVNFIKYRTHIYS
GRWKSVGGLGMSTEGRFERLTALVLILLQFSVAQIYEQTLTHPPNDQALLYNEVVNYRNN
IGHTIADPFVRLPNKRFYPTYYEEIDSPISLKMIRKKILSKKYDTCHDMARDFQLLFSNA
MSFNVSHSLIHKDALTLKEFMESRLQEFATKEENSDRSSDSMGEDDDERTKKKRRRRRKK
RTETLRGRLRLLYETVLDAEDEEGREIIMLFLEKPSKKDYPDYYKLIVDPIDMRTIDKKI
RQERYTDVTGLISDFCLMFNNARQYNEPGSQVYLDANALEKLLLEKNKELGPLPVQPQLA
TPGRTHKKHALPPNVTDGFAFIKSQNPLEDKMDRLYVKLRDHTDPTGRTICDIFSHLPTK
HELPDYYKVIKKPMEMDRIQQKMHGGHYTRLDEMLADLLLMFENACIYNEPGSVIYKDAL
LLQKVAVETFHKLEAPEEVPRSQQLVHEILMNLFMSLMNHQDETGRCYSDSLMLLDQKAS
GLQGKVPFLFPHTHVDVLQSFATLVKLEVVVKMYPSYFKKNIIFLHQLPIKIFFICPLKK
RALNVTRKLNSYCLTPTKLSFPFGLKSTFLETIIRTLPTNKLSIPRALVYKAGDFVYVED
PDKQHEKHIVCIEKLYIDDVGEQRIYGPWFLTAQSIISHFPGKKFMEKEVFKSDYYNTIP
VKCILGRCHVMLVKDYFRMKPAGFKDEDVYVCESRFLSKTKSFKRAKSMQLPANDTPLIA
RETPLSIVRVPSGLGADPQLVTQGVDATWSTDVIDKDRENIKTETQNPHSEATYYIQYFA
NGMWVKLGDCLYVRNPGGKPKIARVERLWTDNNGNVWFHGPWFVRPESTEHEPNRMFFNS
FEDTVLLSDVEGKCMVLSGRDYSACRPTEIPETDIYVYESKYFDKIIKKMKGVKRYVPTH
KVVDDEYYYFKKPFTPENVLSPILLKMVAEDVKQRQIQAVEQKHQKLSMNEHQPPSQGLP
YNQPIYNQQQPLMVQQPYHPYPQSYPQTTATPPLKKKGRVGHSTGYILFASHCHPKVRAD
NPDLPFGDISKLVGEEWRNLDEEEKHEYEEKAREKMAIAEAEGRLIPRKKKKKNGDEVVT
PTITMAPAVVHVYTKVSLKWSWYIIYTNPNLIIIINHFFILKIIKKNPFRAVAQFQQPGQ
YTGIVQGTPQTGYNPTMPAYSQTPTGIVYPAQQIAPVSLLLPRSERHRVKRGPLFLQPPP
KAQRIMHSEAYLKYIEGLEKGSKTLSNWKKTLSVKENDVVMSKEEVDKLPVHWLANGKAR
HETTKSALWALRDLMLKDAFAIKNS
Download sequence
Identical sequences H2ZED8
ENSCSAVP00000015954 ENSCSAVP00000015954 51511.ENSCSAVP00000015954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]