SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016343 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016343
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily PH domain-like 6.52e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000274
Further Details:      
 
Domain Number 2 Region: 206-301
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000017
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016343   Gene: ENSCSAVG00000009620   Transcript: ENSCSAVT00000016524
Sequence length 504
Comment pep:known reftig:CSAV2.0:reftig_30:2738701:2756330:-1 gene:ENSCSAVG00000009620 transcript:ENSCSAVT00000016524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLNMSGPPVQRRHQPVQNVPSSLLSDNENRAVFTMLGRKCVTLATGVVQVYLANGAGTK
WQKRCTGVCCFVKDNPMRSYFIRVFSLKNEQTIWEQELYNQFKYNTPRSYFHTFDTEYCR
AGLNFANEAEANKFKQVVEEKIQQKHEKKRDSPRSSPQPHAPPEIKSAPVCSSMFHGTFV
DDGKKSKKGKKGKKGKLTKADISMPSGFKHVGHVGWDPNKGFDTDNMDPDVKELFKSAGV
TEDDMQDKEKAQFIYDFIEQRGGIDAIKKDQSRDRHAPPPPPPQRNGPPPPPQRNGPPPP
RRKETPRPAPPSHRNQPPPPPPDRSNRQPPPPQHRAAMAPPPPGQRMSQPPIPRGVPAPP
PPPSASAPPPPPPPMAPPPFAGGPPPPPPPLLSNAPPPPPMSGGGRGALLDQIRSGSAAD
RPVESAPSGGGGRGDLLAAIRSTGGIGALKSVSHEVEKPPPAQVEEDGLAGALARALMKR
ENAIHSDSDDDSNEDFDDEEEWSD
Download sequence
Identical sequences H2ZFH7
ENSCSAVP00000016343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]