SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016346 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016346
Domain Number 1 Region: 29-139
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000274
Further Details:      
 
Domain Number 2 Region: 200-295
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000124
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016346   Gene: ENSCSAVG00000009620   Transcript: ENSCSAVT00000016527
Sequence length 428
Comment pep:known reftig:CSAV2.0:reftig_30:2740002:2756337:-1 gene:ENSCSAVG00000009620 transcript:ENSCSAVT00000016527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPPVQRRHQPVQNVPSSLLSDNENRAVFTMLGRKCVTLATGVVQVYLANGAGTKWQKR
CTGVCCFVKDNPMRSYFIRVFSLKNEQTIWEQELYNQFKYNTPRSYFHTFDTEYCRAGLN
FANEAEANKFKQVVEEKIQQKHEKKRAVQHQQHPSYNHPSPQPHAPPEIKSAPVDDGKKS
KKGKKGKKGKLTKADISMPSGFKHVGHVGWDPNKGFDTDNMDPDVKELFKSAGVTEDDMQ
DKEKAQFIYDFIEQRGGIDAIKKDQSRDRHAPPPPPPQRNGPPPPPQRNGPPPPRRKETP
RPAPPSHRNQPPPPPPDRSNRQPPPPQHRAAMAPPPPGQRMSQPPIPRGVPAPPPPPSAS
APPPPPPPMAPPPFAGGPPPPPPPLLSNAPPPPPMSGGGRGALLDQIRSGTGLKSAADRP
VESAPSGG
Download sequence
Identical sequences H2ZFI0
ENSCSAVP00000016346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]