SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016984 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016984
Domain Number 1 Region: 356-601
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-55
Family Nuclear receptor ligand-binding domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 161-245
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-31
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016984   Gene: ENSCSAVG00000009992   Transcript: ENSCSAVT00000017167
Sequence length 784
Comment pep:novel reftig:CSAV2.0:reftig_1:2477029:2485202:-1 gene:ENSCSAVG00000009992 transcript:ENSCSAVT00000017167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMNNVEYSERHQSSREMLHCADYGEVRALSPVIAPHNPHVPVQHFMGFQEHPSQHQSRD
LLHSAPYPIAFANSQRPPSSFVPLGESEPSELCSPSVNGRTYNANTVSFHGYSHHPGSPS
VPTPLETGWPDNSPNGRAPTFEELRWRDAYRNIPARAQIEIIPCKVCGDKSSGIHYGVIT
CEGCKGFFRRSQQNNYAYSCPRHGNCIIDRSNRNRCQHCRLQKCLRAGMSKDAVKFGRMS
KKQRDRLYLEVLKQQQLRSGQPQPESEAFNQTKHSAVTHSPPTETNVTSYFTTAEQRNDV
MVKLEPSNENTFNPNHDPLTPPTVQPVPMESKAAEYSATKNHYYDVPTSSTEPQTNPMPN
YDIAENLMNNICEAYYKTCQYSLDELAKYSKAIRSQEGILQFQNMAPDQLWSFCAEKITE
AIQHVVEFAKHSHAFMSLDQHDQIILLKTGCLEVVMVRMARAFNPSNQTVLFDEKYTHIE
TFRGLGCDDLINGMFEMAKSIAELNLTEDQIALFSFAVLITGDRPGLRESTRLNKLQSVV
LGSLQEMFLKTHSNPQNILTKLVMSMLNLRNLSRLHSKYFLQYKHQFGNILLPPLYKELF
CVDDFQSQQYFPAEPGFDQVQRRTSVCYEGQDIGYIDGSTVGTTELASNGSSGSCAIDGR
CAMIPGPAFAPCTSRSSSTSSVSSSGTAPLGNLSCDDISPMLSDNKSVPGGEQLGLDHIN
HTEEQIQRNQLVEAERLMEAALHEHTPLSNPTGYPVQLTMLAHSQQHLHGHDNNSLGGIP
HLSI
Download sequence
Identical sequences H2ZHB8
ENSCSAVP00000016984 ENSCSAVP00000016984 51511.ENSCSAVP00000016984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]