SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000016999 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000016999
Domain Number 1 Region: 658-745,775-833
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 940-1081
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000102
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 833-895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000319
Family EGF-type module 0.006
Further Details:      
 
Domain Number 4 Region: 881-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000282
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 5 Region: 738-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000629
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000016999   Gene: ENSCSAVG00000009999   Transcript: ENSCSAVT00000017182
Sequence length 1198
Comment pep:novel reftig:CSAV2.0:reftig_14:482967:499568:1 gene:ENSCSAVG00000009999 transcript:ENSCSAVT00000017182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPCDKSNCPPVNNCINETTSEGACCPSCDRLGCRCQGYQYYDCLLNGFVGGLVPEGESYS
VDDGSTMCSCPMGGGMILCRYSPHLPRPFCIQTFTRPADGCEECLAVGCVAEDGQKYQGG
VNFDRPPCTVCYCPPEGGDILCATDHECQERTKQQLGDMEGGYDTRYLQSDWNKFDSSNP
AYQPKGDDGNLGTQNSGSLAAPPLAGSSDASETVAAPGYPAFPYQYPSYDSGRSPNTNNL
AVGSQEPNAGNVESANSQSSPHQAGNYPSDGGNFRQDSTDLSDQTGPNSIPDTSQNVEAG
NPQYPGYPANQQYFGGLNYAGYNSQNTGVEAGDLGSKATTTSTIAAKTTTSTVRPAATTT
VPTSTATTTESTTTVETPAQTSTLADTHHRHPGHRLHGVHLDSHNNSGSFENVLTACCYQ
GKQWALDHNSCTGIRVNVKTYSQICAVAQEKCCLEAEEQENCDRGIAAARSMAVCDAPTA
IHGQCERDGFKSCCDCCALGLKAYGLSLSCDMEILGEPCNSAYSECCRKGRLTTSPGHSR
NQEFPLFAVFYSLCSLFKTKQLAIQSGGRLIRISYSCDDQCKINMWGTDFRQRDLLPAAG
KFRSTAFEVGFKRTDAPCLWKDYPDIPRSLLFSGSAISNSFSIINLTVVLRSCGPIPDPQ
HCYNSVDACDHICTDISSGIQCSCREGYSLEEDGFSCNDINECNLATHTCLVGQICFNTI
GSFTCQRLISCGTGYELTDRNTCDDIDECQLNIHNCGGKLDCVNIRGSFRCVPKSCDAGY
FTDAVGGCTDIDECRSIEYTCPAGTHCRNTVGSYECVCPVGFILNVEQQSCEDIDECALG
FTPCLEEGATCVNTEGSFTCMNRPSLTCTAGYQLNLDGDGCIDVDECESNSHECSTGSTC
INEDGSYRCQDPIFCRPGTRPSENQRSCIDLNFNLIFICNTIIDIDECEDPEVHQCGEGA
QCVNVPGSFRCTCNRGYRRTLQNGRTHCEEINECALAAGERCTYRCENTPGSYTCVCPNG
YNLVRFDGTCKDIDECASGSHNCSESETCFNTRGGFKCVEITCPEHYARLSNKKRCVRQS
CKAARNKRECIRRPKQITYHNISLRNNAAPSTTVFRLSLGKGYPRDRYFFILSKGNKDKL
FRLAKRRYKRRKTGIMYTTRRLTGPNDYVVDLTLKLYRKKKWTTFISRLYIFVSEFDF
Download sequence
Identical sequences H2ZHD3
ENSCSAVP00000016999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]