SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019072 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019072
Domain Number 1 Region: 490-658
Classification Level Classification E-value
Superfamily FAS1 domain 8.76e-18
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1756-1896
Classification Level Classification E-value
Superfamily FAS1 domain 9.03e-16
Family FAS1 domain 0.001
Further Details:      
 
Domain Number 3 Region: 970-1139
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000000131
Family FAS1 domain 0.0069
Further Details:      
 
Domain Number 4 Region: 1156-1269
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000034
Family FAS1 domain 0.0036
Further Details:      
 
Domain Number 5 Region: 914-993,1273-1303
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 6 Region: 188-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 378-508
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000017
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1536-1584,1617-1724
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000322
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 9 Region: 143-271
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000408
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 1432-1562
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00008
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019072
Domain Number - Region: 874-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00433
Family EGF-like domain of nidogen-1 0.026
Further Details:      
 
Domain Number - Region: 2106-2140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Merozoite surface protein 1 (MSP-1) 0.092
Further Details:      
 
Domain Number - Region: 829-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-like domain of nidogen-1 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019072   Gene: ENSCSAVG00000011192   Transcript: ENSCSAVT00000019279
Sequence length 2205
Comment pep:novel reftig:CSAV2.0:reftig_16:3185892:3216174:-1 gene:ENSCSAVG00000011192 transcript:ENSCSAVT00000019279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYYSLQVIIYFFVKVLETSAQDNPRRCDRKTTQRLNTDCQNCRRNRRQNCPAGYIKKTRG
QGIRRCRYRIHRGRHSRPVKGCYHECMKAITVPKCCANHWGTDCQEVDTCGNRGICYDGL
SGNGTCSCRGRIGGSACEICSAPNQYGPSCEHDCACVHGKCDSGVDRPGICSCESGYGGA
RCNIVLAECASLNCHVNSRCLNTTGSLMCICNSGYQGDGVTCEEINPCQDTGSNLCHRNA
SCIHDGPASYKCQCNRGFSGDGQYCGPIDPCQFNYGDCPTNSTICVYTGPGQSTCNCKPG
YTDQTSEGCQLVDICGGSLNTTCDPLANCTTVDAAGLISVKCQCPETMFSWGLSCFSDIM
SELIAANETGPFQNQLNMAINMFTATYNSELSVGDSLVTVFAPIDSAFGSELSSPNSSFL
WKARARMHIVPGSIALDFAQQSANTMYPLFGYNTSIKALRPTGRDSNPDDDDAGYYAILS
FSNMLTNGKIMASNRWASNGVFYFIDTYFGIEEELSISTFSTPAASVWDAIATNPITSTF
YSLLKKSQPTKEFLRSGQQTTLFVPTNDAFDLLSTETMKFLTSEAGENKLDMILLYHATD
QPVTSFELLTTKKLATSSGYLLVNISQSDGIIYIGLQKAKVSNKRSNIYLINKVLIPIDA
EPLLGNFCPKEVEIEVKGLCGDCSNLERLCGPNAQRCTYNARDESGFIGQRLGCSPRCLT
NQTTSACCPGFFGSACNSCPGPTHNACNMKGVCDDGISGGGLCTCNNRHTGPDCSVCTSP
QSYGPECYLNCTCLYGRCDNTISSRGVCIAGSCMANWAGENCDRRVQPCGDRSLQCHQHG
TCVEVDNVESCACDIGYTGNGMDCVEFNPCDDTYDSGGCDVNADCLYFGRGNYSCRCKLF
YRGDGRSCAPINPCTDGLATCHRHAECIFTGPGSNTCQCLPGYRGNGQICDEINLCLENN
GGCHYRATCTSNGPGTSHCECNSGYTGDGSQCVGSLLMEIQDQPQLSVITNFIQNNQIVR
EFFSSVRLITAFLPQKEAWLTMSIDDFQYWNKPNRLIYLLKHHIVKGSYRGGDVGMHVCQ
IISSTCLKRALVCLSNVAANITYSEVIPALGTNKAKIVVADLKTFNGLYHIIDDVLIPPR
DVVQDHPMLQDIVQFAKYSLFFSMLNNSGIIADIISSGQMYTIFAVSNAIFEKFCSPTIP
DQDKNLTLRYHVVLGSVIRTKQVRSGQHFTTLAGSGYQVSLRGRHGETLVNRQEILSRDI
RTANGIIQVNNINLKKFCSKKNLGILRTECMSCVNARCPDGYKLLSRSPSGCPVNSHHLI
YLRMTCRLHCVRITAVKSCCHGFFGRECEPCPGGVNNVCFKHGTCFDGLRGNGTCMCNQS
NYSGIACDECSTGLFGQDCSSKCRCVNGSCDDGKNGLGTCFCNKGWRGEHCDVKVDLNDP
CKGRCHSASECSSGPFSPTCICSAGYTGHASNCTPINVCKQQRFVGCHIDAACMHRGPGR
YECKCKEGYQGDGTYCTEINPCMQANFTRCDSNANCFHTGPNQFHCLCKDGHTGDGKTCV
PIDLCQTANGGCHPFAQCTMQAPGLRDCNCIENYIGDGEYNCTGNDYEWLNQLDTSLTVG
LLNPLSSKGPITLFIPRTYMMPNAPPQLDLQHLVILSFLQLSLVVGCEWLPKSRLQTLSS
MRMLSGDVVNITTSNGNVYLDRNISIDEGQTFSNGMLFTTNGLLTSFKMLNQTTPSSIQW
SNQKNNSLVELNKQELLKHGLNKAVQLLEATGLVNGLSQVVHGRWTLFLPSDKAFMKLPT
HRMRQLSVDGKVAQEYAKFHMIRQSMLAPTDIVQRMQLTTMQGSELRLACSLDRAGEIRI
NDDSTVIGYRVVTFRSSGGGMTASSLYIIDTVLEPPSIGGHCDIITNHTIEGTCSFCSPG
RTMGCPSGMVKIAEKKTQCVSISGDNQYSVAGCAPVCAYYNITQKCCGGYYGSDCHPCPG
GADNTCSRNGVCSDGIDGSGKCTCNPGFHGYACELCETGRYGRKCLPCECTVNGICNEGI
NADGSCICDVGYTGINCDQRSLDPANCNHTCVQNAVCIEGPQCMCNPGYIGTGDYDCKLP
DLCKTTPNGGCSPHASCTQNLLKVTCTCNFPYVGDGYICEGYDPCTDSARQMCHFHARCT
YIGPNITRCNCYNGFIGDGINQCVPEVEAKTCAIENGGCSSRADC
Download sequence
Identical sequences H2ZNA6
ENSCSAVP00000019072 ENSCSAVP00000019072 51511.ENSCSAVP00000019072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]