SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000019461 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000019461
Domain Number 1 Region: 4-233
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-87
Family Calponin-homology domain, CH-domain 0.00000161
Further Details:      
 
Domain Number 2 Region: 252-370
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-33
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 3 Region: 967-1122
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-29
Family Spectrin repeat 0.0000238
Further Details:      
 
Domain Number 4 Region: 558-694
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-28
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 5 Region: 2181-2299
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-27
Family Pleckstrin-homology domain (PH domain) 0.0000986
Further Details:      
 
Domain Number 6 Region: 856-1014
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-27
Family Spectrin repeat 0.00083
Further Details:      
 
Domain Number 7 Region: 1840-1975
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-25
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1184-1337
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-25
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 9 Region: 1407-1536
Classification Level Classification E-value
Superfamily Spectrin repeat 3.64e-25
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 10 Region: 380-479
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-22
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 11 Region: 698-801
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-21
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 12 Region: 1559-1660
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 13 Region: 1717-1835
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-18
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 14 Region: 484-591
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-17
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 15 Region: 1981-2053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000301
Family Spectrin repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000019461
Domain Number - Region: 1346-1434
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0259
Family Spectrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000019461   Gene: ENSCSAVG00000011411   Transcript: ENSCSAVT00000019671
Sequence length 2309
Comment pep:novel reftig:CSAV2.0:reftig_1:4529277:4558348:-1 gene:ENSCSAVG00000011411 transcript:ENSCSAVT00000019671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SILDEREAVQKKTFTKWVNSHLVRVSCRIQDLYMDLRDGRSLIKLLEILSGERLPKPTRG
KMRIHCLENTGKALQFLKSKKVHLENMGPHDIVDGNHRLILGLIWTIILRFQIQDISVET
EDNRETRSAKDALLLWCQMKTAGYANVNVHNFNTSWRDGLAFNAIIHKHRPDLIDYDSLK
KSNAMHNLQNAFNVAEQQLGLTKLLDPEDIVVERPDEKSIITYVVTYYHYFSKMKAIAVE
GKRIGKVLDSALESNQMVEKYDSLASDLLDWIEQTIEILNDRTFANSLSGVSAQLAAFNN
YRTAEKPQKFQEKGNLEVLLFTLQSKMRANNQKPYLPKEGKLVSDINKAWEKLEKAEHGR
ELAIRNELIRQERLELLASRFDRKAAMRETWLSENQKLVTQDNFGGDLPAVEAATKKHEA
IETDVKAYEERVQAVVDVASELQREDYHDITRVNQRKDNVLQLWEYLLELLQGRRTRLEL
NVRLQQMFEEMMSLLDWMDDMKGQLANEDLGQHLMGVEDILQKHMLLEQDITVHGDRVKA
IESQSQEFLQPTNDYSACEPSAVEDKVVGVRTTYDQLCKQAADRRAKLDESRRMHLFFAT
MAEEVAWVKEKEQLLNSDDLGRDLTSVHSLLTKQKALEDEMNGRKAMLANAIAVGEDLIS
EDHFASQDIAKHISDINEQWKNLEELAEARNELLRANKLYQFYADTDDVDTWLVDMFRIV
STDDCGRDEPSVLSLLKKHAQVQEELTKYEGVIKALHDEADGLTEKDRESVEVQERLRSV
DSRYKELLDFAKLRKEKLIDARALYKFYGEADTISAWIAEKEQVLENMLVPDNIEDMELV
QHRFEGYENEVNKLAPQVAVVNQMARGLVQTQHPNSDDVSAKQNELNARWNALRALLEER
REILASAKGLHGFKLECDETEGWIKDKARVLAAGAEDQLSDRDLAGVVALQRKLSSMELD
LAAIQAKLDNLRDEADRLSNEHPEEADEIRKKFEQMERVWQELRDMLRQREDSLGEAGNL
QKFLRDLDRFQAWLSTTQTTIASEDMPQSLPEAEKLLQQHQAIKLEIDNYQADYEEIKST
GAQVTSGREDEPQYMFLGQRLQALDQGWIELHKMWENRNHFLNEAKEYQAFIRDCKQAEQ
ILTNQEYALESARRSSAAASTPDSAEEVMKKHEAFVATMASADERVEAVLRDAGKLADAD
HHAADKIKERAEKIAERRAKNKEEAGEVSTMLRDNLALQKFVADCDELSEWVNEKMLTAK
DATYDDARNLHSKWQKHQAFSAELTANKDRLERLEEDGSTLAKSKPEWKDQIDVRLDDLR
KHWEALESCTKTKEKTLFEANKAELFSQTCEDLEKFASMMEEQLNSDDVGKDLASVNVLL
KDHLAQQDEIEVRKQEVQELESQAAVLRSEGDEDVDTMNEERAKIKHRIEDLDEPLTKRK
DALENSKQLHQFYRDVQDEKLWIDEKHPQATSNELGNSLQEVQALQKKHQALRSELTAHE
PVVVAVCHRGVAMATEDNPNTDKINEKCHELQENWNRWGKLLEDVDERKRKLSEAENAQQ
YFFDADEAVVLMEEQELYMMSDEKAKDSQGATKMLKKHQAQEQNIDDFADTIQQLSKTCR
DLCEQEHPQSEQLSTRQQQVDQTYAGLKDLAEERRMKLRERCDLFRLSRDIDDLEQWIAQ
REVVAASQEQGQDFDHVSMLQDQFNDFQRDTIKTGEERVADAMRMSDELINAGHTDAQDI
AGWKDTIRDAWADLLELIDTRVEMLAAAYALHKFHYDAAEILARIQEKRQEVPEELGRDH
DAVENFKREHDIFAQDIKAIGAQVEAITSAGSELEGRYAGDDLQEIQKKIEAVLSAWNNL
LSLVKKRAALLSDALNKFRFFNMCRDLMDWMESTVRQIDLQEKPRDVSGVETAMSLHQGT
KAEIDARNGSFEECTQLGQHLITTGHYASDEIRVKLDELGAKRNHVVDRWQEKWELNLLM
EVYQFAHDANTCDAWVQQQLGLIRDMPVDTCRSADDADQLLRRLDGFEKAAVPWEDRFAA
LEKLTEVSQEEQEKKRKEEEEQEERRRKAEEDEQKIKKEADPHDVSCGSAEISPTLSTQP
DSALSAACSAVSDDSCAFLTPLTPLYIKQWFKKNLRKFGSGTQMSSQRKNASKGWNEAWW
PVQASAPLTQLTSRSDIARYERTNSPKSPSPDVPYQGFLKRKSTMFSPSKKAPNRSWNSV
FCVLQDKNLAFYKDPKAASQRASFHGEQSISLENATIEIASDYKKRKNVLRLRLSAGMEY
LFQAKDEEELNVWLNRLQSQNLNASIGSG
Download sequence
Identical sequences H2ZPE5
ENSCSAVP00000019461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]