SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78188437|ref|YP_378775.1| from Chlorobium chlorochromatii CaD3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78188437|ref|YP_378775.1|
Domain Number 1 Region: 104-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-69
Family RecA protein-like (ATPase-domain) 0.0000000524
Further Details:      
 
Domain Number 2 Region: 64-139
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.31e-27
Family Cold shock DNA-binding domain-like 0.0000878
Further Details:      
 
Domain Number 3 Region: 11-53
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000129
Family Rho termination factor, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78188437|ref|YP_378775.1|
Sequence length 429
Comment transcription termination factor Rho [Chlorobium chlorochromatii CaD3]
Sequence
MANNPVVKGLDINLLQRKKVAELHALAKELGVMAAGLRKEELIFKIIEAQAQRTNDPDSA
TVMVNTGVLQVIPEGYGFLRSANYNYLSSPDDIYVSPSQIKRFNMRTGDTVSGQVRAPKE
GERFFALLKINTIDGNDPEITRERPFFENLTPLFPTQRLRLETRQSEMCGRIMDIYTPVG
KGQRGLIVAQPKTGKTMLLQMIANAIIQNHPEVYLIVLLIDERPEEVTDMARSVAAEVVS
STFDEDPERHVLVADMVLEKAKRLVEVGRDVVVLLDSITRLARAHNTIIPHSGKILSGGI
DANALTKPKRFFGAARNIEEGGSLTIIATALVDTGSRMDDVIFEEFKGTGNMELVLDRRL
SERRIFPSIDILRSGTRREELLFSQEELSRTWLLRKYLADKNPVECMEFMREKMADTKDN
RDFFKYMNA
Download sequence
Identical sequences Q3ATE3
WP_011361505.1.38767 gi|78188437|ref|YP_378775.1| 340177.Cag_0459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]