SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338534273|ref|YP_004667607.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338534273|ref|YP_004667607.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 6.59e-24
Family DNA-binding N-terminal domain of transcription activators 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338534273|ref|YP_004667607.1|
Sequence length 267
Comment hypothetical protein LILAB_23170 [Myxococcus fulvus HW-1]
Sequence
MLTISQFADRCGLSPSALRFYERKGLLLPSARRANGYRAYAPGQVGEARFISSLRAAGIS
LSAIREFLRKDARTRETMLTSWRQDLSARLLSLQLADQYLRGLGAASGPRVHLEQWAEPS
VLVWFPATAPPGPLAFRAAVPACKKELERRGIPVLTSGYVRTLDVARGQLLGEVGFRIKP
RRRLPPGSRGQEVPPTLFATLECAVRDEQAAHRVFRFLAELGFRPDGLHLERYLSGVADR
YLLMLSVRRLGPVAADGGGGSSPGPLE
Download sequence
Identical sequences F8CMQ7
gi|338534273|ref|YP_004667607.1| WP_013939656.1.19289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]