SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338530819|ref|YP_004664153.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338530819|ref|YP_004664153.1|
Domain Number 1 Region: 550-711
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.01e-41
Family Histidine kinase 0.0027
Further Details:      
 
Domain Number 2 Region: 172-337
Classification Level Classification E-value
Superfamily GAF domain-like 1.83e-18
Family GAF domain 0.0056
Further Details:      
 
Domain Number 3 Region: 344-466
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.93e-18
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 4 Region: 46-157
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000014
Family Flavin-binding PAS domain 0.069
Further Details:      
 
Domain Number 5 Region: 478-562
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000981
Family Homodimeric domain of signal transducing histidine kinase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338530819|ref|YP_004664153.1|
Sequence length 723
Comment sensory box histidine kinase [Myxococcus fulvus HW-1]
Sequence
MADEQRDAAAVKDAPGKASGTVPADVACDLLSPMKPRAAHAGSQVESERFQHLSELLHEV
VFQLDAQGRLTVLGGAWERLTGTPVADWRGRALLDAIHAEDRARARAVLAYTPDRPAPRE
EVRLDVGGGRGVRWVELSARALATVPGEVMGTLLDVTSRRSAEEAVTTRERYLEAMVQVQ
RRMMGHELPDDLYGAVVEPLGHVSDASRVYVFEMHLGEDGALLASQRAEWCAPGVPPNLE
DPNMHGLPFNEALRPHQSEKLLRGEPVQGQPRDFTEMLAPMLEAQAVRSVLLLPLHVHGQ
LFGVIGFDNCREPQRWGPIEVNLLSGAAGALSLALEQRTANALRMRTETTLRRTEAGVHL
LIEAFPDPVLVHVGDGVLLSVNPALVQYLGFRDASELVGRHMLDLVRPEDRGAAQLHLSQ
ALEGKSAARVVEMPLVRSDGEVVVADLVTLAVVLDGSPARITVARDFTERKRTQAQLMLT
DRMASMGLLAAGIAHELNNPLAYVLSNLDFLHSAVGGTRPRMLSPEDLVELKQVLDDARE
GAERMRQIVRQLRVFSRVEDGKEESVDIHAVLESVSQMAASVVRARARLVKDYGEVPLVR
GNEGKLFQVFLNLLINAAHAIEEGDSEANEIRLTTRMEVGRVTVVVSDTGQGIPPEHLRR
IFDPFFTTKSSGLGTGLGLSICDTIVTALGGHISVESSVGAGTTFRVALSAAPPKAPVNR
PGG
Download sequence
Identical sequences B8QZS2
WP_013936244.1.19289 gi|338530819|ref|YP_004664153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]