SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338536088|ref|YP_004669422.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338536088|ref|YP_004669422.1|
Domain Number 1 Region: 178-375
Classification Level Classification E-value
Superfamily HCP-like 0.00000000000942
Family HCP-like 0.014
Further Details:      
 
Domain Number 2 Region: 692-865
Classification Level Classification E-value
Superfamily TPR-like 0.000000000886
Family Tetratricopeptide repeat (TPR) 0.0061
Further Details:      
 
Domain Number 3 Region: 339-377,429-508
Classification Level Classification E-value
Superfamily TPR-like 0.0000312
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  gi|338536088|ref|YP_004669422.1|
Domain Number - Region: 67-111,151-210
Classification Level Classification E-value
Superfamily TPR-like 0.000124
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Domain Number - Region: 568-665
Classification Level Classification E-value
Superfamily TPR-like 0.0843
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338536088|ref|YP_004669422.1|
Sequence length 1189
Comment hypothetical protein LILAB_32315 [Myxococcus fulvus HW-1]
Sequence
MRRSLLVCLVLLATASAAQEKKAPRDADLGRKSATSVDKSLAGDITREKKKKEEVAPALQ
YDQFRLGVELQVASKRREQIQSLKKIISLSPDPKEAPSLLFRLGEFYWEESKFYFFEANR
KDDDLIQAMNRNDAAGQKRAKAEKVELVAKQKEYGKLAVEQYTKIVQEYPNFERTDEVLF
FLGQYLMEDGQDRKALVAFKRLVEKHPTSKFIPDAYLAFGEYYFNNSKGKRQELEKALVA
YKKAADFPESQVYAFALYKQGWCHYNMGDYAAAKDKFKTVVLYGELAGASAVEKDGGKSG
RSSLVREARTDYVRAYAHEGDVSQARAEFGKVATNPEDRFTMLKQLANLYYGDGKDREAA
ITYNRLIKEKPLSPEAPGFQGRIVDCILRMGNKERTVVQVRRLVKIMKEVESSGVIKEDK
DKKLLAEAKELSERTLSNLAVTWHNEGKKTRNEETFRYADAVYSDYLTLFPENPKAYDLR
FFWAELLNDNLQNFDKAAANYTLVVLQDAKVLEAKDDKGKPKPGKPGKWLQNAAYNAVLA
YDEVVKAAEARGEAKSEAVGSDITKKAAIPTLKKALLDACERYLKYVPKGEKRVEIAFKA
ANIYYRHNHFDEAVLRFSEIALGYPEYKFENGERAAEISANLILDSYHLLQDYAKVNEWA
RRFYANDKLAVGKFRDDLAKLIEQSSFKLVSQLEEKKEFEKAAEAYLAFVKDFPQTEIAD
LALYNASVDYYKAKRLDKAIEVRKRLFAEYPRSKHVPDSIYANAEALEAIGDFEDAASTY
EAYVRGYERSLGEKGNARARRGKRRGAASDKPAVVQKWDESKAQVALFNAATYREGLGQM
KAALRNREHYLALWPRAKDADEIRLSIIDLTGRSGAAFKAIKMLEQYERDNMRSPSRYLA
AEGRIVDLYKKMGRSRDVARMYKRIYEHFDQLPRRVQGALEKPALATAAQAQFLSVELDW
NQYRRLNLYWGVPPSPNRFKASIQDKSRALQVVEKKYVQTVTLGAPEPAICALHRIGLAY
DHFAERLTNAPMPRGLDEESQQALRDEFANQAQPLKDKATEAFAATVAKSRELDVYNDCA
AESLKLLRTTYQPDRYPEMPEAKVALKSHVQLIGGDLLATIQDVPPPAPKAASEAQQARA
ETLQEDLTDLTAQLRSQTETQVDARPAATPNGATPAKQGGDEEEPEDFL
Download sequence
Identical sequences F8CAW3
gi|338536088|ref|YP_004669422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]