SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338536249|ref|YP_004669583.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338536249|ref|YP_004669583.1|
Domain Number 1 Region: 101-357
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-65
Family Protein kinases, catalytic subunit 0.00000823
Further Details:      
 
Domain Number 2 Region: 570-706
Classification Level Classification E-value
Superfamily TPR-like 0.000067
Family Tetratricopeptide repeat (TPR) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338536249|ref|YP_004669583.1|
Sequence length 822
Comment serine/threonine kinase family protein [Myxococcus fulvus HW-1]
Sequence
MNETYEEELLLAMDEGLLSGEEAAALREEALRLRRGPLELLRERGRLSEDSMLALREELA
AESTDPGAARPLEAATLTPATPGVAPPPAGEPDGPTFPVPDWDRYQPVRFLGQGGMGRVF
LAYDPMLRRNVALKFVRGDDPELARRFLSEARAQARVRHERVCEVYEVGEVRGRGYIAMR
YVDGQPLGQLARSLTLEQKVVVLRQAAEGVHAAHGAGLIHRDIKPGNILVERTEDGGLAP
FVMDFGLARDWREDGAAPNAVQGTPRYMAPEQARGEVSRLDRRADVYSLGATLYSLLTGR
PPFTGATEAEVITRLQHEEPAPPRALDADIPSDLEAIVLKCLEKQRPARYDSARALAEDL
QRFLDGEPVLARQGLGYRLRRKARKHRVALTLGSAALTVVLLALIQTAIARGEVAERERL
TRRFTERVERIEASARYSALSRLHDTREDRRELRASMDALEAEVREAGPHALGPGQYALG
RALLVLDDRDAARKRLEAAWAQGYREPRVAWALAQVLGDLYQERLLLDVERRSPEQRELR
RKELEQDYRDPALAYLRQAEGPDVPVPPLYVKALFAFYEGRHEEALTHLEAMGRAQPWFY
EAPLLQGDVLLARATQRWHQGDKAGSQEDLDAGRRAYTAAIATAESQPTGHYVLARLELA
ALVMELYGEGNVLPYYERGVEAATRALTAAPDHHRALVVLSRLHRRLPGPRTHPDLRAVP
AGTHRLRHAHSPAPGDDMKFLCDACERLPPPPAPPARGAAHQPGARGRGAAAGEVHPRRA
RGPGPGSAGGPRRAGAGHHPPALGPLPAGARAGPGRAAPPVD
Download sequence
Identical sequences F8CDL5
gi|338536249|ref|YP_004669583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]