SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304314166|ref|YP_003849313.1| from Methanothermobacter marburgensis str. Marburg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304314166|ref|YP_003849313.1|
Domain Number 1 Region: 65-199
Classification Level Classification E-value
Superfamily Sortase 2.09e-24
Family Sortase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|304314166|ref|YP_003849313.1|
Sequence length 202
Comment sortase related protein [Methanothermobacter marburgensis str. Marburg]
Sequence
MRKNSIYAAIICLFFVSITSGIIIKAFEDYQTRKRSRVHLENYRNAPRDFFDPVPSGPNT
VAGSRGPVIGKLIIPSIGVSCWIREDTVNAYESVYHYPESVMPGSAGDCGILGHRTTYSG
PFRRIGALRRGDMVIIEDHLSSRRYVYVVTSNGDDIRWDYKVNPVRFAQNGEARLMLITC
YPPGKKKAAWITHCKLVRKENI
Download sequence
Identical sequences D9PUV3
gi|304314166|ref|YP_003849313.1| WP_013295227.1.93414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]