SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526050|ref|YP_003668074.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526050|ref|YP_003668074.1|
Domain Number 1 Region: 322-431
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.00000000177
Family Pseudouridine synthase II TruB 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|297526050|ref|YP_003668074.1|
Domain Number - Region: 87-127
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0235
Family Rad50 coiled-coil Zn hook 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297526050|ref|YP_003668074.1|
Sequence length 437
Comment THUMP domain-containing protein [Staphylothermus hellenicus DSM 12710]
Sequence
MEESSTENQSAKIIKTAKALLARYPLCHHCLGRQFAKYGLQLKNSERGYAIKTILQMILH
KELQDKIIDKETLRKYAVNAGDPITRLYEKIYEEKVEPAKCYICGNKLGEEYFEDLARKV
AELLEQYNAYTFIVGVSLSQETMLREIEVSSFSGLETSESIKNEIKREVGKIVRDKYGYI
PDFDRPDVMVIIDYETDMVRAVVNPILFEGRYWKRGRNISHTIWLSKTGIKEYPYSLEEF
FNDRLREIFESERIVLHASGREDVDARMLGTGRPMVIEVKNPRFRYVDMDLINELLRSTL
IEAEITGYSSRAKIEYLKGEGSKKRKAYKILVYTAEPITSDKLRMLEEEYRNRVIHQRTP
KRILRRKKDTLRIRRVYEVKTKLLHNKLFEAIVYCDGGLYVKELVHGDDGRTTPSFSDVL
GVQAYPLELDVFVVETK
Download sequence
Identical sequences D7DAH8
WP_013142373.1.49614 gi|297526050|ref|YP_003668074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]