SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526166|ref|YP_003668190.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526166|ref|YP_003668190.1|
Domain Number 1 Region: 85-174
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.31e-24
Family eIF2alpha middle domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 176-262
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 8.63e-23
Family eIF-2-alpha, C-terminal domain 0.00083
Further Details:      
 
Domain Number 3 Region: 7-88
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.36e-19
Family Cold shock DNA-binding domain-like 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297526166|ref|YP_003668190.1|
Sequence length 267
Comment translation initiation factor 2 subunit alpha [Staphylothermus hellenicus DSM 12710]
Sequence
MPIPRKELPNVGEYVIATVKKIFDYGAYVTLDEYNGLEAYLPWSEVASRWVRNIRDVIRE
NQKIVVKVIRVNRRRKTVDVSLKKVPENEKRRKVLWWKRYLKASKIVELVAEKIGKSIED
AYREVVWKLEDYYGDPLLGLEEAVIRGPDALREAGIPEEWIKPLYNDALRHVKVKMVKIR
GLMFLRSYESDGVERIKKILLSAKEILDKVGDNVKGRIYLLGSPRYVVEITAPDYKEAEK
ILKEILATTEKLAKELKVEFRFERERK
Download sequence
Identical sequences D7DAU4
gi|297526166|ref|YP_003668190.1| WP_013142489.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]