SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526231|ref|YP_003668255.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526231|ref|YP_003668255.1|
Domain Number 1 Region: 104-252
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.67e-18
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.017
Further Details:      
 
Domain Number 2 Region: 10-103
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000000721
Family Ferredoxin reductase FAD-binding domain-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526231|ref|YP_003668255.1|
Sequence length 258
Comment Dihydroorotate dehydrogenase, electron transfer subunit, iron-sulfur cluster binding domain-containing protein [Staphylothermus hellenicus DSM 12710]
Sequence
MKTILKHSIRYYSIKLLSNNKISSNLYLLMFKTLDKPVTEPKPPQFIMLWVPGYEAIPMS
VAGFNGENNTLSILVKPVGPTTKYLASMSCGSYLGMYGFLGREYIPPGNKFLFIAGGSGL
APILYYLKYLGCTPHKCHVLFGCWRRGEIGDAPRLISKLGGKPYTACLGECDYQGTILDA
YTRINLEGYDAVIVSGPPEMIKNMLDKVNNTVNHYFILEETIKCGIGLCGKCSLGKLDKL
LCIDGPLFNYEDTVRVYS
Download sequence
Identical sequences D7DB09
gi|297526231|ref|YP_003668255.1| WP_013142554.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]