SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526334|ref|YP_003668358.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526334|ref|YP_003668358.1|
Domain Number 1 Region: 5-28
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000889
Family HIT zinc finger 0.023
Further Details:      
 
Weak hits

Sequence:  gi|297526334|ref|YP_003668358.1|
Domain Number - Region: 43-88
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00288
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526334|ref|YP_003668358.1|
Sequence length 102
Comment hypothetical protein Shell_0327 [Staphylothermus hellenicus DSM 12710]
Sequence
MVFCLRVCDICEHKPAKYKCPVCGRHVCEDDFDFEKGVCKVCSETLCEICGKYPSIGYCM
VCGRNGCEDCLIQVTPVSYVCKDCIRQGRYRLETKQSLLRRR
Download sequence
Identical sequences D7DBB2
gi|297526334|ref|YP_003668358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]