SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526566|ref|YP_003668590.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|297526566|ref|YP_003668590.1|
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily Prefoldin 0.00288
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526566|ref|YP_003668590.1|
Sequence length 41
Comment hypothetical protein Shell_0562 [Staphylothermus hellenicus DSM 12710]
Sequence
MEESIESKIRELENRINILEQRIDRIEKIIDEIYVLLRAHL
Download sequence
Identical sequences D7DBZ4
gi|297526566|ref|YP_003668590.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]